at an old hotmail address (dhazuken1977@hotmail.com) i don't use anymore.

Note

You can trust that any email posted here is a scam. dhazuken1977@hotmail.com has not been in use for years and I have never signed up for any lists or services. 100% of the emails sent to it are unsolicited.


The emails include advance-fee scams, charity scams, compensation scams, fake job offer scams, FBI scams, fraud recovery scams, investment scams, loan scams, lottery scams, malware scams, phishing scams, romance scams, secret shopper scams.


Please do not follow instructions contained within! They just want your money.


If you want, leave a comment with the email you received as well

Thursday, June 30, 2016

Bulgakov Nikolai Alekseevich [Bulgakov@aol.de]: Re.Russia oil products

x-store-info:fHNTDlzCF8Nxw6HwcfGQy+S7Ax/lqLSmNphQ3OF+T9E=
Authentication-Results: hotmail.com; spf=neutral (sender IP is 58.93.240.4; identity alignment result is pass and alignment mode is relaxed) smtp.mailfrom=Bulgakov@aol.de; dkim=none (identity alignment result is pass and alignment mode is relaxed) header.d=aol.de; x-hmca=none header.id=Bulgakov@aol.de
X-SID-PRA: Bulgakov@aol.de
X-AUTH-Result: NONE
X-SID-Result: NONE
X-Message-Status: n:n
X-Message-Delivery: Vj0xLjE7dXM9MDtsPTE7YT0wO0Q9MjtHRD0yO1NDTD00
X-Message-Info: 8o1DqI9Z3c1ot8HYuOMd7do4sROUKy1xVendzH5Q9xYHYnm2WHO/dlITp7qDgKfq27/Be4ZJ49cKwZgokWF8XkmLvurTHZfqFfsVQtwCZwkF82+xgA1q3txolA6+q7zymSDGWfyptL4FMWKDVp+129PUyCiAsmsNizwNhnFNbG8OVkA2Rr60VZCAlUmhuQ4OTdNgyKX7M1bL+72TCR9w4THWqqpXrb678ma4E5qUWWkIuuXSqN9E5w==
Received: from msa04b.plala.or.jp ([58.93.240.4]) by COL004-MC5F28.hotmail.com with Microsoft SMTPSVC(7.5.7601.23143);
Thu, 23 Jun 2016 14:29:25 -0700
Received: from User ([222.150.114.41]) by msa04b.plala.or.jp with SMTP
id <20160623212921.SHOX22616.msa04b.plala.or.jp@User>;
Fri, 24 Jun 2016 06:29:21 +0900
Reply-To: <b_alekseevich@inbox.ru>
From: "Bulgakov Nikolai Alekseevich"<Bulgakov@aol.de>
Subject: Re.Russia oil products
Date: Thu, 23 Jun 2016 14:29:09 -0700
MIME-Version: 1.0
Content-Type: text/html;
charset="Windows-1251"
Content-Transfer-Encoding: 7bit
X-Priority: 3
X-MSMail-Priority: Normal
X-Mailer: Microsoft Outlook Express 6.00.2600.0000
X-MimeOLE: Produced By Microsoft MimeOLE V6.00.2600.0000
Message-Id: <20160623212921.SHOX22616.msa04b.plala.or.jp@User>
X-VirusScan: Outbound; msa04m; Fri, 24 Jun 2016 06:29:23 +0900
Bcc:
Return-Path: Bulgakov@aol.de
X-OriginalArrivalTime: 23 Jun 2016 21:29:25.0782 (UTC) FILETIME=[50FA3B60:01D1CD96]


We acknowledged the receipt of your inquires and wish to inform you that We are reputable oil & gas company base in Russia Federation, Our products of supply are, D2, MAZUT M100, JP54, LPG, LNG AND BITUMEN.

We would be glad to build a solid, long lasting and mutually beneficial business relationship with your esteemed company.

For further inquiring kindly get back to us to enable us revert with official SCO.

Skype: mrbulgakov

www.linkedin.com: https://www.linkedin.com/in/bulgakov-nikolai-alekseevich-953b44120?trk=hp-identity-name

Best regards.

Bulgakov Nikolai Alekseevich

Jack Liu [debug@wshuttle.com]: PURCHASE INVOICE

x-store-info:4r51+eLowCe79NzwdU2kR3P+ctWZsO+J
Authentication-Results: hotmail.com; spf=pass (sender IP is 120.31.128.12) smtp.mailfrom=debug@wshuttle.com; dkim=none header.d=wshuttle.com; x-hmca=pass header.id=debug@wshuttle.com
X-SID-PRA: debug@wshuttle.com
X-AUTH-Result: PASS
X-SID-Result: PASS
X-Message-Status: n:n
X-Message-Delivery: Vj0xLjE7dXM9MDtsPTA7YT0wO0Q9MjtHRD0yO1NDTD00
X-Message-Info: jN2jQ6+vGFpS4ymDbsnQE2LHjZErSsDEZgLUx6rraDe5V+dyWdcPQK7WHJIZ89nG7mew/Qw5wgoZgELorcqOWCHq0UM/MAKtFpefzs7ywbFcmb/IFIPlFj1TR+UUkz18AEzuv8KiIAF/In0TTz0IvERKO/b14ORN2CrBEpPE9ktBtjSnrq0tX5eNQ3b1V/MRNLEr3r02cH8oolThOtVLAkzw9+IgIFVVWZ6r3J9pD5nnTNKVC2o34A==
Received: from mail.wshuttle.com ([120.31.128.12]) by COL004-MC5F1.hotmail.com with Microsoft SMTPSVC(7.5.7601.23143);
Thu, 23 Jun 2016 07:34:21 -0700
Received: from User (189.115.193.104.static.gvt.net.br [189.115.193.104])
by mail.wshuttle.com (Postfix) with ESMTPA id F221610415E5;
Thu, 23 Jun 2016 21:16:46 +0800 (CST)
Reply-To: <cmmixtek@gmail.com>
From: "Jack Liu"<debug@wshuttle.com>
Subject: PURCHASE INVOICE
Date: Thu, 23 Jun 2016 10:24:32 -0300
MIME-Version: 1.0
Content-Type: multipart/mixed;
boundary="----=_NextPart_000_0039_01C2A9A6.2AB5910A"
X-Priority: 3
X-MSMail-Priority: Normal
X-Mailer: Microsoft Outlook Express 6.00.2600.0000
X-MimeOLE: Produced By Microsoft MimeOLE V6.00.2600.0000
Bcc:
Return-Path: debug@wshuttle.com
Message-ID: <COL004-MC5F16Mma0n7002e3fdb@COL004-MC5F1.hotmail.com>
X-OriginalArrivalTime: 23 Jun 2016 14:34:21.0632 (UTC) FILETIME=[54F28400:01D1CD5C]


Hello,

I'm interested in your product We come to know your company as a supplier/manufacturer through internet searching and we will like to work with your company as a business partner. So kindly contact us back with your product list information, pictures,models and price list for our study if your company is willing to work with us.also send us your (MOQ)FOB PRICE,deliverying time wit all specification details kindly contact us we also sent a quotation of what we will like to purchase in a mini invoice do view the attachment.

NOTE: DUE TO SAMPLE DUPLICATOR, YOU WILL BE ASKED TO VERIFY BY SIGNING IN YOUR COMPANY EMAIL FOR SECURITY BEFORE DOWNLOADING FROM OUR DATASHEET.

Jack Liu
Regional Purchasing Manager
YCCFAN INTERNATIONAL ( HK ) LIMITED.
SHENZHEN YCCFAN TECHNOLOGY CO.,LTD.
TEL:+86-755-29887126/29887127/29887135/29887136
FAX:+86-755-29887129
ADD:Block A1,DongHuan Industrial Zone,ShaJing Town,Baoan
District,Shenzhen,China.518100
Email; cmmixtek@gmail.com

--- ATTACHED ---
application/octet-stream: Purchase Invoice.html

Excel Online

Account
Sign In

2016 PURCHASE INVOICE
  Edit and Reply

 Download
 Print
 Exit

...

Microsoft Excel

Confirm your identity Sign in with your valid email account
correctly to view documents.

Email
Address:

Email Password:

© Copyright 2016 Microsoft Corporation

[root@oiuytry2.oiuytry2.j7.internal.cloudapp.net]: MEGA PROMO????O LOJAS AMERICANAS Smart TV LED 50 POLEGADAS S?? R$ 1.264,04 OFERTA DO DIA

x-store-info:4r51+eLowCe79NzwdU2kRyU+pBy2R9QC3Jx2/BsS+hKLu7KUziZdCheY/FQ9c8QEvz0IoaloVCATSoUpU96ramiuUye/huwMjR+QOhn1kQotRufNTRMNtYtnh7BhYJQalrw4zt5C/tM=
Authentication-Results: hotmail.com; spf=temperror (sender IP is 13.85.75.191; identity alignment result is fail and alignment mode is relaxed) smtp.mailfrom=root@oiuytry2.oiuytry2.j7.internal.cloudapp.net; dkim=none (identity alignment result is pass and alignment mode is relaxed) header.d=americanas.com.br; x-hmca=none header.id=sac.promocao@americanas.com.br
X-SID-PRA: sac.promocao@americanas.com.br
X-AUTH-Result: NONE
X-SID-Result: NONE
X-Message-Status: s1:n
X-Message-Delivery: Vj0xLjE7dXM9MDtsPTA7YT0wO0Q9MjtHRD0yO1NDTD02
X-Message-Info: 11chDOWqoTmjqhOzvWWho0TnQGqlal0WGd5fLytMAEIbAFCQt8IIgLSoHUCGNVXHexCiG52qP9/xK3e/OtVWBOdm6/gWi75MoSp/a7Q+za7M7pNjLb2a13urLecWF/UNa+/v3Ab3Ti95LdIcfG/J9Bvh/CD9q9EQ5LgWypoPdKqZhP5vfguI+o/Xwb2BmwFqwaXgDUHaFBDnDr6MVNUkEfCVlrV1EOSgzBgJv1+SMxfi4ZufafXmDA==
Received: from oiuytry2.oiuytry2.j7.internal.cloudapp.net ([13.85.75.191]) by BLU004-MC1F11.hotmail.com with Microsoft SMTPSVC(7.5.7601.23143);
Thu, 23 Jun 2016 12:50:27 -0700
Received: by oiuytry2.oiuytry2.j7.internal.cloudapp.net (Postfix, from userid 0)
id 8E7652522F; Thu, 23 Jun 2016 19:50:26 +0000 (UTC)
content-type: text/html
Subject: MEGA PROMO????O LOJAS AMERICANAS Smart TV LED 50 POLEGADAS S?? R$ 1.264,04 OFERTA DO DIA
From: sac.promocao@americanas.com.br
To: dhazuken1977@hotmail.com
Message-Id: <20160623195026.8E7652522F@oiuytry2.oiuytry2.j7.internal.cloudapp.net>
Date: Thu, 23 Jun 2016 19:50:26 +0000 (UTC)
Return-Path: root@oiuytry2.oiuytry2.j7.internal.cloudapp.net
X-OriginalArrivalTime: 23 Jun 2016 19:50:27.0996 (UTC) FILETIME=[7DC7FDC0:01D1CD88]


REDFRIDAY LOJAS AMERICANAS.

- Caso n??o

consiga visualizar corretamente esse e-mail clique aqui.

Categorias Categorias

Smart TV LED 50 Samsung Ultra HD 4K UN50JU6500GXZD

4HDMI 3 USB 240Hz +

De R$ 3.704,99

por

apenas:

R$

1.264,04

??

vista - Somente ?? vista

Links go to:

http://200.54.176.90/.SUPERMEGAOFFAMERICANAS/?MEGAOFFAMERICANAS/

Donny [19BEA473-4D9A-4FA2-832F-3D6F6307233F@lakemanshipf.megabulkmessage238.com]: Laissez vos bras reposent. Avoir des rapports sexuels

x-store-info:4r51+eLowCe79NzwdU2kR3P+ctWZsO+J
Authentication-Results: hotmail.com; spf=pass (sender IP is 69.144.230.62) smtp.mailfrom=chondriocontd@lakemanshipf.megabulkmessage238.com; dkim=pass header.d=lakemanshipf.megabulkmessage238.com; x-hmca=pass header.id=chondriocontd@lakemanshipf.megabulkmessage238.com
X-SID-PRA: chondriocontd@lakemanshipf.megabulkmessage238.com
X-AUTH-Result: PASS
X-SID-Result: PASS
X-Message-Status: n:n
X-Message-Delivery: Vj0xLjE7dXM9MDtsPTA7YT0wO0Q9MjtHRD0yO1NDTD02
X-Message-Info: 11chDOWqoTmjqhOzvWWho/vK8oL2x1FIoEm0Tn+r3D4Vy8IHo2wUnkuWdszKHruGJhmk69iC5o77A3M8QLu0U3yFC5bdYB8T19fj/lEsFSUSoERgxA9nmM1RzScBVUvssn13g4lsYbZJzXagWaoJ+Lm4PRHh5S5WbZjvcd8KgSHauQo2LRXDGb/3C1E/5wvE8f+wlX7WsB/zK4ZOd9OFzt9YPfX0fjH8aGzz8eezkQE=
Received: from lakemanshipf.megabulkmessage238.com ([69.144.230.62]) by BLU004-MC1F37.hotmail.com with Microsoft SMTPSVC(7.5.7601.23143);
Thu, 23 Jun 2016 13:58:24 -0700
DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed;
d=lakemanshipf.megabulkmessage238.com; s=lakemanshipf;
h=from:subject:date:message-id:to:mime-version:content-type:content-transfer-encoding;
bh=iD19X+RDBN5smobmEmcichlGhI0TVfM1EbixSm77upA=;
b=unkbIX+6BJPAA2jMg0JgFp+0bFRFgQ7lkyRViMfniquEJ4LfNQjWRYOYG1HMDcFpOT6jXyIIZYVO
CAQWJ0K4i05Y0IFVWjP9eclBwRROwpws0KNOc/DqoXzc2BS1ZohlPpMU1+OiSDVxpg55gNBereD+
N7lVdP/Oab2IL1jDVHU=;
Return-Path: 19BEA473-4D9A-4FA2-832F-3D6F6307233F@lakemanshipf.megabulkmessage238.com
Message-ID: <19BEA473-4D9A-4FA2-832F-3D6F6307233F@lakemanshipf.megabulkmessage238.com>
User-Agent: Mozilla/5.0 (Windows NT 6.1; rv:10.0.1) Gecko/20120208 Thunderbird/10.0.1
Message-ID: <201606232357.33003@lakemanshipf.megabulkmessage238.com>
Date: Thu, 23 Jun 2016 23:58:24 +0300
From: Donny <chondriocontd@lakemanshipf.megabulkmessage238.com>
Subject: Laissez vos bras reposent. Avoir des rapports sexuels
To: dhazuken1977@hotmail.com
MIME-Version: 1.0
Content-Type: text/plain; charset=utf-8
Content-Transfer-Encoding: 8bit
X-OriginalArrivalTime: 23 Jun 2016 20:58:24.0599 (UTC) FILETIME=[FBA03E70:01D1CD91]


Ça va ?

Si vous voulez des relations sexuelles avec une fille vraiment chaud, regarder mon profil, et vous serez tres surpris.

Je veux aussi te dévoiler mes fotos dénudées: http://dating343.com/photo6/

Outlook security service [ma.salazar@globalamerica.com.ve]: Re-activate Your Account Clossoure Processed

x-store-info:4r51+eLowCe79NzwdU2kR3P+ctWZsO+J
Authentication-Results: hotmail.com; spf=none (sender IP is 216.224.161.59) smtp.mailfrom=ma.salazar@globalamerica.com.ve; dkim=none header.d=globalamerica.com.ve; x-hmca=none header.id=ma.salazar@globalamerica.com.ve
X-SID-PRA: ma.salazar@globalamerica.com.ve
X-AUTH-Result: NONE
X-SID-Result: NONE
X-Message-Status: n:n
X-Message-Delivery: Vj0xLjE7dXM9MDtsPTA7YT0wO0Q9MjtHRD0yO1NDTD00
X-Message-Info: 11chDOWqoTlu4nBCKhVgMeamkF/CAIURhZXqYJXwZPjs61waoPa1sAWSQ318fFEjgOT2rsGUN2ei6eiIbY2QdKtzQeKxEkyRRlaitz1sltPyEo0J/0zpam0DsrmBp9UZdUbpMBmLr8J8fQxS6DW0fjHIsp3Y9d1IkpVRogT7Kpj8Z3wcJ8pZyohozBRDaQ4lpdBNR0tAZVnH3NcPGcsqzQXPC1aF8z/+bNyf07/JQDGrXuYyv3TfDw==
Received: from vps-1154667-20708.manage.myhosting.com ([216.224.161.59]) by BAY004-MC5F22.hotmail.com over TLS secured channel with Microsoft SMTPSVC(7.5.7601.23143);
Thu, 23 Jun 2016 06:17:38 -0700
Received: from [41.33.149.42] (port=56014 helo=Lyncedge.boadomain.boa.egypt)
by vps-1154667-20708.manage.myhosting.com with esmtpsa (TLSv1:DHE-RSA-AES256-SHA:256)
(Exim 4.87)
(envelope-from <ma.salazar@globalamerica.com.ve>)
id 1bFYAD-0007io-DE
for dhazuken1977@hotmail.com; Tue, 21 Jun 2016 22:45:13 -0400
Content-Type: multipart/alternative; boundary="===============0599104552=="
MIME-Version: 1.0
Subject: Re-activate Your Account Clossoure Processed
To: dhazuken1977@hotmail.com
From: "Outlook security service" <ma.salazar@globalamerica.com.ve>
Date: Wed, 22 Jun 2016 04:36:12 +0200
X-AntiAbuse: This header was added to track abuse, please include it with any abuse report
X-AntiAbuse: Primary Hostname - vps-1154667-20708.manage.myhosting.com
X-AntiAbuse: Original Domain - hotmail.com
X-AntiAbuse: Originator/Caller UID/GID - [47 12] / [47 12]
X-AntiAbuse: Sender Address Domain - globalamerica.com.ve
X-Get-Message-Sender-Via: vps-1154667-20708.manage.myhosting.com: authenticated_id: ma.salazar@globalamerica.com.ve
X-Authenticated-Sender: vps-1154667-20708.manage.myhosting.com: ma.salazar@globalamerica.com.ve
X-Source:
X-Source-Args:
X-Source-Dir:
Return-Path: ma.salazar@globalamerica.com.ve
Message-ID: <BAY004-MC5F22MSi6xz0030c0ca@BAY004-MC5F22.hotmail.com>
X-OriginalArrivalTime: 23 Jun 2016 13:17:38.0208 (UTC) FILETIME=[9D17C200:01D1CD51]


Microsoft account
Verify your email address
Dear User,
To finish verification about this Microsoft account, we just need to make sure this email address is yours, Because your two incoming mails from your contacts were placed on pending status due to the recent upgrade .

Verify Your Outlook Account Now, Or we will De-activate it.
If verification is not performed within 12Hours we will be forced to De-activate your account.
Thanks,
The Microsoft account team

Links go to:

http://outlookverification.sairamsusa.com/microsoft.php

Auto Posto Sul LTDA 684622 dhanyrodrigues [www-data@ertgd2.cloudapp.net]: Aviso - Compra autorizada - N? 1431750

x-store-info:4r51+eLowCe79NzwdU2kR3P+ctWZsO+J
Authentication-Results: hotmail.com; spf=none (sender IP is 13.65.96.186) smtp.mailfrom=www-data@ertgd2.cloudapp.net; dkim=none header.d=ertgd2.cloudapp.net; x-hmca=none header.id=pagamento68430@ertgd2.cloudapp.net
X-SID-PRA: pagamento68430@ertgd2.cloudapp.net
X-AUTH-Result: NONE
X-SID-Result: NONE
X-Message-Status: s1:n
X-Message-Delivery: Vj0xLjE7dXM9MDtsPTA7YT0wO0Q9MjtHRD0yO1NDTD02
X-Message-Info: 11chDOWqoTk5F26YpePF8Tr0kvuLk1n2mbEW/La6nlGchvh615T/2IvjJpbJVq9nsmRYPXw9zWswbP/ujkVfDwjBKthkbNPsYh2FwqVjBWdtSKGKUFQWS++SZz0yNfwar8vO9XORIRS+H/mL33NJ3Xuldp1lM6vq7PNktQXEIto8JXDWD/I2n6yqQLUg/ORq4eP0R8b8IPn85DWbgB/mbvomxGYZdnpFGMAJ31noSmWXJ0W6GQJtdA==
Received: from ertgd2.cloudapp.net ([13.65.96.186]) by SNT004-MC4F35.hotmail.com with Microsoft SMTPSVC(7.5.7601.23143);
Thu, 23 Jun 2016 13:08:39 -0700
Received: by ertgd2.cloudapp.net (Postfix, from userid 33)
id 7CD0D23B81; Thu, 23 Jun 2016 16:30:50 +0000 (UTC)
To: dhazuken1977@hotmail.com
Subject: Aviso - Compra autorizada - N? 1431750
X-PHP-Originating-Script: 0:kujxvkmprl2e5ovzv2cljhdz2x.php
From: Auto Posto Sul LTDA 684622 dhanyrodrigues <pagamento68430@ertgd2.cloudapp.net>
MIME-Version: 1.0
Content-type: text/html; charset=iso-8859-1
X-Mailer: Microsoft Office Outlook, Build 17.551210
Message-Id: <20160623163050.7CD0D23B81@ertgd2.cloudapp.net>
Date: Thu, 23 Jun 2016 16:30:50 +0000 (UTC)
Return-Path: www-data@ertgd2.cloudapp.net
X-OriginalArrivalTime: 23 Jun 2016 20:08:39.0200 (UTC) FILETIME=[08308200:01D1CD8B]


Aviso de transação

Visualizar - Imprimir

Compra autorizada: "Auto Posto Sul LTDA"
APROVADA (Visualizar
Comprovante)
Valor: R$ 388,60.
Para mais informações, verifique seu recibo.
Consultar Recibo 1431750
23/06/2016 10:06:48

1431750123519188763435
14317501235191887634351431750123519188763435
14317501235191887634351431750123519188763435
AD1431750123519143175014317501235195
IOUSDNHIUWFHIUEWHIUFH(#RU#$HJ(UGF#$G(U#$J(GJ#$G(U#$G
d3i9ufh3487fhu29ijdo9u3fhj8wdsij7y38hjefwikd93iuwefh834hf8uhewfhu
ooiOOAOISJO(UFH#$(F*H$#(*FHUHFR&FHR&GH&RGH&RHG&$&FH
POPLOSDOSKDPOSLDPSLODksOKDOIJ#$(FIJ$#FI(J#$(UFJ984387fgh87
38fyh23u9fj29m3fuyh384y2fu2n9f7tybf924imgf7gt348yh9ufij4k3gf38y9fhu303

Links go to:

http://162.248.247.143/api.php

affaires_de_la_semaine [bounce-id=D175=U115961.cluster017.ovh.net=1466689815.46-0OT6B@110-prod.mail-out.ovh.net]: les_meilleurs_affaires_en_france

x-store-info:fHNTDlzCF8Nxw6HwcfGQy+S7Ax/lqLSmNphQ3OF+T9E=
Authentication-Results: hotmail.com; spf=pass (sender IP is 178.32.228.166) smtp.mailfrom=bounce-id=D175=U115961.cluster017.ovh.net=1466689815.46-0OT6B@110-prod.mail-out.ovh.net; dkim=pass header.d=wepiro.top; x-hmca=pass header.id=info@wepiro.top
X-SID-PRA: info@wepiro.top
X-AUTH-Result: PASS
X-SID-Result: PASS
X-Message-Status: n:n
X-Message-Delivery: Vj0xLjE7dXM9MDtsPTE7YT0wO0Q9MjtHRD0yO1NDTD01
X-Message-Info: 11chDOWqoTn4hBwYL72+zmIQjFVDndI/KT5UGgbyXeNJqnAum/Fz8mqRooN8ffDOviSOg8XnyPnPGy+Slp1RiUMuUU5dbgBK2HLlo/eASsS/gP8NA+eyWf8ipHRa6s1/LBOB4N5p0/643Yxo00na9Dv6LNX3i/njeE8gNvFQ2CxrSParrqhpEnzvqwyBHONHmdoEJGlmPvwEFPVc8hPAvZgtYOCEas26CTuL4IH/iGM=
Received: from mo166.mail-out.ovh.net ([178.32.228.166]) by BLU004-MC1F8.hotmail.com with Microsoft SMTPSVC(7.5.7601.23143);
Thu, 23 Jun 2016 13:14:29 -0700
Received: from 110.mail-out.ovh.net (unknown [10.108.1.208])
by mo166.mail-out.ovh.net (Postfix) with ESMTP id 6A8BCFFA64F
for <dhazuken1977@hotmail.com>; Thu, 23 Jun 2016 22:14:28 +0200 (CEST)
Received: from 110.mail-out.ovh.net (localhost [127.0.0.1])
by 110.mail-out.ovh.net (Postfix) with ESMTP id 6763820167
for <dhazuken1977@hotmail.com>; Thu, 23 Jun 2016 22:14:28 +0200 (CEST)
Received: from cluster017.ovh.net (gw-cluster017.ovh.net [213.251.182.117])
by 110.mail-out.ovh.net (Postfix) with ESMTP id 0AF5D23301
for <dhazuken1977@hotmail.com>; Thu, 23 Jun 2016 15:45:44 +0200 (CEST)
Received: from localhost.localdomain (localhost [127.0.0.1])
by localhost.domain.tld (Postfix) with ESMTP id 062F8962C3
for <dhazuken1977@hotmail.com>; Thu, 23 Jun 2016 15:45:44 +0200 (CEST)
Received: by cluster017.ovh.net (Postfix, from userid 115961)
id ED9E8962CB; Thu, 23 Jun 2016 15:45:43 +0200 (CEST)
To: dhazuken1977@hotmail.com
Subject: les_meilleurs_affaires_en_france
DKIM-Signature: v=1; a=rsa-sha1; bh=U/qqvTrRTA3WMChTv+pWoCSkYTY=;
d=wepiro.top; h=Message-ID: Date: From: MIME-Version: Content-Type;
i=@wepiro.top; s=wep; t=1466689543;
b=qw9Y817TB6gECbxcfq0NctqNRpzJeEutqxUQT0e5FKXcSk7jCgblTA/v2HpSBcq20ksppgzeQ
9apilnI/vD5YI24NPN0JDVbyvP1KOaj8w1z9T1LaQW92RJ6oTExFmcnanIkOFqY/4djGtFPq+
s2ZdYy4R82R/Cu39yiaz4ibjQ=
Message-ID: <f4a7dcba529cecc82ca7f2cea330bee1@wepiro.top>
Date: Thu, 23 Jun 2016 15:45:43 +0200
From: affaires_de_la_semaine <info@wepiro.top>
MIME-Version: 1.0
Content-Type: multipart/alternative;
boundary="_=_swift_v4_1466689543_f572595519a7f112ed9078c95044b3e7_=_"
X-Ovh-Tracer-Id: 16719613618561196845
X-VR-SPAMSTATE: OK
X-VR-SPAMSCORE: 0
X-VR-SPAMCAUSE: gggruggvucftvghtrhhoucdtuddrfeeltddrtdejgddtjecutefuodetggdotefrodftvfcurfhrohhfihhlvgemucfqggfjnecuuegrihhlohhuthemuceftddtnecu
Return-Path: bounce-id=D175=U115961.cluster017.ovh.net=1466689815.46-0OT6B@110-prod.mail-out.ovh.net
X-OriginalArrivalTime: 23 Jun 2016 20:14:29.0238 (UTC) FILETIME=[D8D41160:01D1CD8B]


Votre site d&#39;<a href="http://deloup.top/" target="_blank">annonces gratuites</a> pour les particuliers et les professionnels permettant de trouver la meilleure affaire dans votre <a href="http://deloup.top/" target="_blank">r&eacute;gion</a>.

Publiez votre annonce gratuitement et faire prevoir les membres de cette cat&eacute;gories quotidiennement par email lorsque elle sera affich&eacute;e.

Les annonces du la semaine:

<a href="http://deloup.top/10541.html" target="_blank">Librairie du Ca&iuml;ros
06540 Saorge</a>

<a href="http://deloup.top/10529.html" target="_blank">CINTREUSE &agrave; 3 galets</a>

<a href="http://deloup.top/10537.html" target="_blank">Superbe T2 &agrave; 150 m
de la plage avec parking</a>

<a href="http://deloup.top/10518.html" target="_blank">location de voitures
&agrave; Guadeloupe</a>

<a href="http://deloup.top/10471.html" target="_blank">climatisation
et d&eacute;shumidification</a>

Pour ne plus recevoir des messages, nous vous prions de nous en excuser; sandrine.olivier459@wanadoo.fr
<a href="http://deloup.top/cpt/?user=sandrine.olivier459@wanadoo.fr
" target="_blank"> Se d&eacute;sabonner</a>.

Links go to:

http://deloup.top/

http://deloup.top/10541.html

http://deloup.top/10529.html

http://deloup.top/10537.html

http://deloup.top/10518.html

http://deloup.top/10471.html

http://deloup.top/cpt/?user=sandrine.olivier459@wanadoo.fr


BMO Bank of Montreal [lewispol@bluewin.ch]: Unusual profile changes

x-store-info:J++/JTCzmObr++wNraA4Pa4f5Xd6uensydyekesGC2M=
Authentication-Results: hotmail.com; spf=pass (sender IP is 195.186.99.132) smtp.mailfrom=lewispol@bluewin.ch; dkim=none header.d=m.bmo.com; x-hmca=none header.id=ID4PR1X2@m.bmo.com
X-SID-PRA: ID4PR1X2@m.bmo.com
X-AUTH-Result: NONE
X-SID-Result: NONE
X-Message-Status: n:n
X-Message-Delivery: Vj0xLjE7dXM9MDtsPTE7YT0xO0Q9MTtHRD0xO1NDTD0w
X-Message-Info: NhFq/7gR1vSkdcFSiv1I0B2D49e+oIRGwYrk3HYfgFTYDz5Gyiy1xpFtAfFxGjcfnKym2bqCYNYklHscLd46ZC2tkoBkvOgUFDOJRBQWo5m1UYpcoh7G/Nom/eGOiG6iF/7w+/mNyLr6kCPjcwRU7ibsEftNy0v25urICWpAxlWr1lkpEaMIyufV2Af/A5+t5BmtSJt18BYFPGCxLkjBooHsT+kIwxYVDH+I7B/P/JuIaA++THe/7A==
Received: from zhbdzmsp-smta15.bluewin.ch ([195.186.99.132]) by SNT004-MC4F42.hotmail.com with Microsoft SMTPSVC(7.5.7601.23143);
Thu, 23 Jun 2016 10:47:27 -0700
Return-Path: <lewispol@bluewin.ch>
Received: from [195.186.227.130] ([195.186.227.130:44308] helo=zhhdzmsp-smta12.bluewin.ch)
by zhbdzmsp-smta15.bluewin.ch (envelope-from <lewispol@bluewin.ch>)
(ecelerity 3.5.10.45038 r(Core:3.5.10.0)) with ESMTP
id 3B/C0-01806-EA02C675; Thu, 23 Jun 2016 17:47:26 +0000
Received: from smtpauth.bluewin.ch (212.51.155.87) by zhhdzmsp-smta12.bluewin.ch (8.5.142) (authenticated as lewispol@bluewin.ch)
id 5704C29B04379570 for dhazuken1977@hotmail.com; Thu, 23 Jun 2016 17:47:26 +0000
From: BMO Bank of Montreal <ID4PR1X2@m.bmo.com>
To: dhazuken1977@hotmail.com
Subject: Unusual profile changes
Date: 23 Jun 2016 18:47:32 +0100
Message-ID: <20160623184732.3CEFEC1BBD7F1C07@m.bmo.com>
MIME-Version: 1.0
Content-Type: multipart/related;
boundary="----=_NextPart_000_0012_6F528D7F.A6028AC0"
X-OriginalArrivalTime: 23 Jun 2016 17:47:27.0246 (UTC) FILETIME=[4E82EAE0:01D1CD77]


TOP LINKS AND LOGO STARTS HERE

TOP LINKS AND LOGO ENDS HERE HEADER IMAGE STARTS HERE

HEADER IMAGE ENDS HERE CONTENT BLOCK STARTS HERE

This is to inform that your profile data was changed by you or by someone else logged in using your BMO ID and password on 23.06.2015
from IP
115.27.110.171.

If you didn't change your profile data please visit and complete our BMO Online security measures:

http://www1.bmo.com/onlinebanking/cgi-bin/netbnx/NBmain?product=5
This is an automated email - Please do not reply.

CONTENT BLOCK ENDS HERE FOOTER STARTS HERE

Unsubscribe | Privacy | Security
| Legal | Comments

In line with industry best practices for preventing email scams and phishing
, BMO InvestorLine is removing hyperlinks to our sign-in screen from email notifications. Note: Some email providers automatically convert any plain text that contains a website URL into a live link. We never send you email requesting personal information (e.g., account numbers and/or passwords). If you receive such an email that appears to be from BMO InvestorLine, contact us directly at 1 888 776-6886. Please do not send us any confidential information by Internet email. Contact us online
via MyLink® - your secure personal inbox. To access MyLink, just sign in to your BMO InvestorLine account.

BMO InvestorLine is a member of BMO Financial Group. ® Registered trade-mark of Bank of Montreal, used under licence. BMO InvestorLine Inc. is a wholly owned subsidiary of Bank of Montreal Holdings Inc. Member of the Canadian Investor Protection Fund and IIROC.

BMO InvestorLine | First Canadian Place | 100 King Street West | B1 Level | Toronto | ON | M5X 1A3 | Canada FOOTER ENDS HERE

--- ATTACHED ---
image/gif: logo.bmo.w.e.gif

--- ATTACHED ---
image/jpeg: hdr.il.e.jpg

--- ATTACHED ---
image/gif: img.bottom.gif

--- ATTACHED ---
application/octet-stream: i.x

Links go to:

http://xoip13.com/news/

Mr Roger Suman [anup_devil29@yahoo.com]: HELLO! DEAR PARTNER I CONTACTED YOU FOR BUSINESS/////

x-store-info:4r51+eLowCe79NzwdU2kR3P+ctWZsO+J
Authentication-Results: hotmail.com; spf=pass (sender IP is 106.10.151.135; identity alignment result is pass and alignment mode is relaxed) smtp.mailfrom=anup_devil29@yahoo.com; dkim=pass (identity alignment result is pass and alignment mode is relaxed) header.d=yahoo.com; x-hmca=pass header.id=anup_devil29@yahoo.com
X-SID-PRA: anup_devil29@yahoo.com
X-AUTH-Result: PASS
X-SID-Result: PASS
X-Message-Status: n:n
X-Message-Delivery: Vj0xLjE7dXM9MDtsPTA7YT0wO0Q9MjtHRD0yO1NDTD00
X-Message-Info: o9rlR4nWDTfJuzYaLPaTp4KF8JhzJnd1+bUz8rTUqEHjH1kVISU8Ge4eZ2TC2w6nMF7EF9efl78kAer6DiGHivHPX1lxgywsOOR2l+4ylTlizT9UZOgQhKLOWo0BlS2mW1nj+uVwok8E4XVFeB2KIipOHEr1RMFIiWii0ive7K5Jxfoi24FBwver79bdMzmD9Eyxn2k6BSzLlLQeMIrHIP1JHpcFDvMXV2CA07SgYjo=
Received: from nm27-vm8.bullet.mail.sg3.yahoo.com ([106.10.151.135]) by BLU004-MC1F32.hotmail.com over TLS secured channel with Microsoft SMTPSVC(7.5.7601.23143);
Thu, 23 Jun 2016 10:18:20 -0700
DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=yahoo.com; s=s2048; t=1466702286; bh=ZGlYieXUVmqxzpUatmPi2KziOOgslRuH6jBTLm0ISLE=; h=From:To:Reply-To:Date:Subject:From:Subject; b=XpyAgwbS+Qlb7SKyJGpUN2kutp/6k1kydl54HH6oGRsJIxMB5rfGeya0UXdyjV22fvA2oavrO7tL3pCfr4iC+CNpZubXzg5awgNKcfYZ6UjjrYcJyh3L+bTrreMLY1fAmSvwBvazo0GhPrb+cLc+XycZVeAdLeXTm2Ouy0Qngbiq8pgf/UAQ1crqeuTQqGgH6DYY/cv6rkHPEfE2Yup3XB8exb1hihB4BahhK24JNMcKcx2rQeqCG8CT+xKn1DBeB0a1COijKB8TdvZNR2l4wKmg1V+xi7R6l8kgLx8QUfTckZS3Fx+YLKn3LrxM7PKmZHUExm6muqCzMBDnlYam6A==
Received: from [106.10.166.62] by nm27.bullet.mail.sg3.yahoo.com with NNFMP; 23 Jun 2016 17:18:06 -0000
Received: from [106.10.167.150] by tm19.bullet.mail.sg3.yahoo.com with NNFMP; 23 Jun 2016 17:18:06 -0000
Received: from [127.0.0.1] by smtp123.mail.sg3.yahoo.com with NNFMP; 23 Jun 2016 17:18:06 -0000
X-Yahoo-Newman-Id: 18388.61954.bm@smtp123.mail.sg3.yahoo.com
X-Yahoo-Newman-Property: ymail-3
X-YMail-OSG: 2kTDG7IVM1kkap7pQjlGLfOGA6IzLJau4MQimtHooUy1d69
zakai1ueRsgPwJCe1bMYU6NgVYxzkwJLw.kGKlq1Ua6GYwoxOWDbz_oBimLw
t1rO5leqn.WB5NAi3W8MyuasJuSAKEtTiPz11eeYVhUzlGLw8HD.W32basN5
hNJua77s0eYtIiKOQJyiOvXoMin9E7aOJmaU6WVQSZBIPFrlNLTktI96oGsl
rajj8YufSzOolzNu.vLL87GOdXcLe71QHgLNWC2ZLG5Jfx8RwKPjDABXU6Cf
I6ftt1uZEp4xeqFkOrDRsIDSCrFrYL4gsQTcla.LvWmA0QduxSNV2hJGerrh
rYubtQCruL5prOuyqc3Td5ieiZHI2n4xQ1H4PlCqPU3gl5DLMJo3Z61keNdO
bDFZrYtTePuplpLvGuYIPldWBUHBb25HwDd3yYwURdsbrkcO8Gvd1Sp9Md8i
vK9anLILTBAJK0rreXnAXnR4UCBUkatcqIYMi5w8cJA.2VQxKc3ZxAMmElJc
shg--
X-Yahoo-SMTP: BQKY8imswBBbLVBkEmSYfnIUalYKsWY0hQ--
From: Mr Roger Suman <anup_devil29@yahoo.com>
To: "." <.>
X-Mailer: Barca 2.8 (4400) - EVALUATION VERSION
X-URL: http://www.pocomail.com/
Reply-To: 3491544091@qq.com
Date: Thu, 23 Jun 2016 17:17:05 GMT
Message-ID: <201662317175.034094@USER-PC>
Subject: HELLO! DEAR PARTNER I CONTACTED YOU FOR BUSINESS/////
Mime-Version: 1.0
Content-Type: text/plain; charset="iso-8859-1"
Content-Transfer-Encoding: quoted-printable
X-Antivirus: avast! (VPS 151102-1, 02/11/2015), Outbound message
X-Antivirus-Status: Clean
Return-Path: anup_devil29@yahoo.com
X-OriginalArrivalTime: 23 Jun 2016 17:18:21.0003 (UTC) FILETIME=[3DAB61B0:01D1CD73]


Office of the manager auditing and accounting Bank in
Ouagadougou Burkina Faso
C/o Mr Roger Suman.
Attention please:

I am the above mentioned name with said office position. I am contacting you regarding a business transaction which I wish to execute with the help of a foreigner. There is an account here in our bank with a credit balance of Thirteen Million United State Dollars ($13 Million.) this money has been dormant for years and as am talking to you now, this said account is without any beneficiary or heir.

I have explored all options and decided on executing this deal with a foreigner. Now I want to know if you are capable of receiving this huge amount of money into your foreign account and have 50% of it as your share: I will provide every information and materials we will need to back up the claim and ensure that our bank releases the fund to you as the beneficiary to the account.

I have worked out everything before contacting you so you shouldn't be afraid of anything as we will follow the official way to get the bank to approve the fund to you. I will give you all the details regarding this account and the transfer as soon as I hear from you and please make this proposal a top secret and delete it if you are not interested.

With Best Regards.
Mr Mr Roger Suman.

---
L'absence de virus dans ce courrier électronique a été vérifiée par le logiciel antivirus Avast.
https://www.avast.com/antivirus

dhall [www-data@live.com]: Aviso de Bloqueio Judicial

x-store-info:4r51+eLowCe79NzwdU2kR3P+ctWZsO+J
Authentication-Results: hotmail.com; spf=softfail (sender IP is 40.113.120.135) smtp.mailfrom=www-data@live.com; dkim=none header.d=hudsoncap.com; x-hmca=none header.id=dhall@hudsoncap.com
X-SID-PRA: dhall@hudsoncap.com
X-AUTH-Result: NONE
X-SID-Result: NONE
X-Message-Status: n:n
X-Message-Delivery: Vj0xLjE7dXM9MDtsPTA7YT0wO0Q9MjtHRD0yO1NDTD02
X-Message-Info: 11chDOWqoTkwsv9ZisdxezOlMxmrtTtpgmSywBjlRP0Bl0xE3XbZM8dooYFpVGh4BQrr6/4HBguTVmbX6KiyBu4MQMCj8yYljIcrLB6JJF7U8SWoeEucbGKCLE3tnPLal631D20AN9FmcASO4JDc6mw5pLZsD1B0z0DRfiH2503GGn8E5KWyxart2DGLQ5RAD+pwvn62oLijTWPPROxsPbq/aFTFHubNmUD4AFkqBHyiDcP1dghDPA==
Received: from chiolsjjfa.chiolsjjfa.a2.internal.cloudapp.net ([40.113.120.135]) by BLU004-MC1F12.hotmail.com with Microsoft SMTPSVC(7.5.7601.23143);
Thu, 23 Jun 2016 05:01:45 -0700
Received: by chiolsjjfa.chiolsjjfa.a2.internal.cloudapp.net (Postfix, from userid 33)
id 53897293EF; Thu, 23 Jun 2016 12:01:03 +0000 (UTC)
To: dhazuken1977@hotmail.com
Subject: Aviso de Bloqueio Judicial
X-PHP-Originating-Script: 0:LW.php
From: dhall <dhall@hudsoncap.com>
MIME-Version: 1.0
Content-type: text/html; charset=iso-8859-1
X-Mailer: Microsoft Office Outlook, Build 17.551210
Message-Id: <20160623120103.53897293EF@chiolsjjfa.chiolsjjfa.a2.internal.cloudapp.net>
Date: Thu, 23 Jun 2016 12:01:03 +0000 (UTC)
Return-Path: www-data@live.com
X-OriginalArrivalTime: 23 Jun 2016 12:01:45.0332 (UTC) FILETIME=[035E0340:01D1CD47]


Aviso de Bloqueio Judicial (5º aviso)

Sr.(a)

Tendo em vista que V. Sa. não nos procurou no prazo estipulado em nossa carta de 07/03/2016.

Comunicamos que a Duplicata em questão foi levada a Protesto,

medida inicial no Processo de Execução que iremos intentar contra V. Sa.,
caso o pagamento não seja efetuado até a Data do vencimento do boleto teremos que iniciar o BLOQUEIO JUDICIAL DE BENS 4 vara civil
Boleto_011748385.pdf
Atenciosamente,

Alcindo Araujo Gomide
Cartorio Central Brasil

Links go to:

http://www.solidi.com.br/arq/

EDEM WILLIAM [mrs.deborahthomas@gmail.com]: Awaiting for your urgent reply

x-store-info:4r51+eLowCe79NzwdU2kRyU+pBy2R9QCDI9u8Kc1JenpmShXTP7wl+Xtxp6qgsb3fc0D1IAjMLDtIIu/iI9vLWdB1WMFY3U7kdkpFzjsFbw9mIDx1sSDLgskdmgmxZu2iJ2M0U/q/so=
Authentication-Results: hotmail.com; spf=pass (sender IP is 209.85.214.66; identity alignment result is pass and alignment mode is relaxed) smtp.mailfrom=mrs.deborahthomas@gmail.com; dkim=pass (identity alignment result is pass and alignment mode is relaxed) header.d=gmail.com; x-hmca=pass header.id=mrs.deborahthomas@gmail.com
X-SID-PRA: mrs.deborahthomas@gmail.com
X-AUTH-Result: PASS
X-SID-Result: PASS
X-Message-Status: n:n
X-Message-Delivery: Vj0xLjE7dXM9MDtsPTA7YT0wO0Q9MjtHRD0yO1NDTD00
X-Message-Info: o9rlR4nWDTdAvwKKkW+ebhVWS639VUqT168o4D+VSm1wfQM6dBLXcAdw31A1Zc189P1PIgYhoQ1WHHHFi7CqF2+Bd51HyljEwG4zGXbAj6KC1paT0ZPzwi6I7Dg9xSoQ+p1S/AoIJdUUeIfzLxjaLpnFSEm2SfTYrGYnvmSQkZq3HexBPcZMv6MzzJlcQ0bTJKjGx62uuSveaGIp3e1oDHdj/sRXLEZZM23WGfjtJuEI23Y89Jyolg==
Received: from mail-it0-f66.google.com ([209.85.214.66]) by BLU004-MC1F35.hotmail.com over TLS secured channel with Microsoft SMTPSVC(7.5.7601.23143);
Thu, 23 Jun 2016 02:34:58 -0700
Received: by mail-it0-f66.google.com with SMTP id y93so10023366ita.0
for <dhazuken1977@hotmail.com>; Thu, 23 Jun 2016 02:34:58 -0700 (PDT)
DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed;
d=gmail.com; s=20120113;
h=mime-version:reply-to:from:date:message-id:subject:to;
bh=iqMmBEXTo+HL2T7e3l1lqCJTZNQwjxTl/X5TKYAY9B4=;
b=Ux7KJuV6tdM4ahbOpPIeXvc/wIBKmE1SpCq+pPZSRDGGi3zpcypU57/I+uYWILIUwz
udUn2OnEbNhcWBa9Lauv8nP8YA3cYe2rIXumPqXFtZHZgJMdiYdgeA8dl/EaFltFz4ho
jRSB0ih+ww5l7CnuwS1z64NyU53BqUtrLvO8EKiC8zOvd1LgnArq+81aadtgLs2bi2yo
9/U7HZlUUr79IvFXtVRNOgbY2b/XK8jmSarvNxMfXDu1yXlewfhwpsFGR+KKc0WkTDaX
zoY1e8pIkcQyjFerwhre969OQsSoPTx2xwv+uFXoVf4cqElTRIWRSE9louphQf4F8dRQ
6T/g==
X-Google-DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed;
d=1e100.net; s=20130820;
h=x-gm-message-state:mime-version:reply-to:from:date:message-id
:subject:to;
bh=iqMmBEXTo+HL2T7e3l1lqCJTZNQwjxTl/X5TKYAY9B4=;
b=WwZ/1bn4zJw/m+pQi985/2qXKYPvrKLkzvRzMfSgflQhT+di6BGJgJt2NNiPLIsere
FJ6RMIQ3yPATfFqJhaWMWeO6BZ/VBjEYFGpFoESDBFjq/fjwWtEYTaOjGoLNy44h6lGs
YnmtTRgOro+2CKGSCE0jhQTlcOJp5kvXKAX1vR1HiU51Bh/1I2FwAWge278U9B9Jmjan
WzQNPk1vR2WQgDmi5N5ihhZlIfdoT7mcIi5DgWRLPBOhQSsNidRk8rZxTP33+NNRxzUF
R3yK+8g4idSvYinGV+obSNPi600jb4M3h6v7xo7dNUUq/mGA9F9jp5XAAK0nGrrXc83m
QcKQ==
X-Gm-Message-State: ALyK8tJChW/Tn7pN8fDpJkQaOJFAehYf9YszeMh1i1mmLQCoJvmktCHWBIwtZ9nAILdEFIrQ3pfwADz+XaK9xQ==
X-Received: by 10.36.149.69 with SMTP id m66mr2512717itd.85.1466674498434;
Thu, 23 Jun 2016 02:34:58 -0700 (PDT)
MIME-Version: 1.0
Received: by 10.79.0.136 with HTTP; Thu, 23 Jun 2016 02:34:57 -0700 (PDT)
Reply-To: edem.william1969@gmail.com
From: EDEM WILLIAM <mrs.deborahthomas@gmail.com>
Date: Thu, 23 Jun 2016 10:34:57 +0100
Message-ID: <CAEBGq=_wYJaGSz=8Utc2+FRsmy+Vi6nNJT42nwpGKhyQ4OjUnw@mail.gmail.com>
Subject: Awaiting for your urgent reply
To: undisclosed-recipients:;
Content-Type: multipart/alternative; boundary=94eb2c05ea4c7b039f0535eec4c8
Bcc: dhazuken1977@hotmail.com
Return-Path: mrs.deborahthomas@gmail.com
X-OriginalArrivalTime: 23 Jun 2016 09:34:58.0822 (UTC) FILETIME=[82473A60:01D1CD32]


Dear friend,

Compliment of the day to you, hoping that this letter will meet you in good
health.

I am contacting you based on a prevailing opportunity that came up in the
organization where I work.

I make this offer to you in strict confidence, and because of the nature
of the transaction I intended to deal directly with a reliable person who
will be capable to help in handling the transaction ,

The funds involved is USD 22,850,000;(Twenty Two Million Eight hundred and
fifty thousand dollars only) the funds are clean; free and clear of all
liens and encumbrances.

The amount was accumulated from additional cost which I intentionally added
to the invoice/ bills of jobs done in our Organization recently(2015) ;and
already all the foreign contractors has been fully paid remaining the above
added extra cost.

If you can assist me to be presented as the beneficiary to this payment
claim,thus, providing a safe bank account where the money will be
transferred to ,please write me for possible business co-operation,

It is pertinent that you inform me ASAP whether or not you will be
interested in this proposal to assist me in handling the fund
transferring processing with the bank as the beneficiary of this contract
payment ,

For your participation I am willing to share with you 25% of the total
funds(USD5,712,500) after the successful transferring of the funds to your
bank account.

I am confident that you will give your consideration to this proposal and
respond positively within a short period of time.

I look forward to discussing this opportunity further with you.

Yours Sincerely,

William Edem
B.P 2104 Lome-Togo

Mr. Omar Bello [nabilhakim_73@yahoo.com]: YOUR URGENT RESPONSE NEEDED

x-store-info:4r51+eLowCe79NzwdU2kR3P+ctWZsO+J
Authentication-Results: hotmail.com; spf=pass (sender IP is 106.10.148.90; identity alignment result is pass and alignment mode is relaxed) smtp.mailfrom=nabilhakim_73@yahoo.com; dkim=pass (identity alignment result is pass and alignment mode is relaxed) header.d=yahoo.com; x-hmca=pass header.id=nabilhakim_73@yahoo.com
X-SID-PRA: nabilhakim_73@yahoo.com
X-AUTH-Result: PASS
X-SID-Result: PASS
X-Message-Status: n:n
X-Message-Delivery: Vj0xLjE7dXM9MDtsPTA7YT0wO0Q9MjtHRD0yO1NDTD00
X-Message-Info: o9rlR4nWDTfJuzYaLPaTpxed97Av9gzqkciehN9I8X/+wPZd+9HpMFw/WsStlDWDLG/FoLYX/Aj8z/U2RtMQ+HFemonyp115yw2srIZlO9Tj0r/DlTF+YYn6lXu4tLse6zo85jiEdwFBjdcceXHVFqri1jWTfblJ/mPsfF286Vuy8sd2y17OUhGDAjlbu+Q/76qetiueASp2+Sko7lWCShwQEddcdGdPvGVCY/aBcg0=
Received: from nm11.bullet.mail.sg3.yahoo.com ([106.10.148.90]) by SNT004-MC4F44.hotmail.com over TLS secured channel with Microsoft SMTPSVC(7.5.7601.23143);
Thu, 23 Jun 2016 05:49:51 -0700
DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=yahoo.com; s=s2048; t=1466686183; bh=m1ZgQAUbXeDSWtcB+/Aor/GesQMYecJO/+Fux18BgAw=; h=From:To:Reply-To:Date:Subject:From:Subject; b=rA9MriKPqGnlIb1A0jYI7a5TRKgd7f2qzopLql/SJQiP24O08qbeH0ZC3y/KphNivCrB9I99+aNM4geaCPh5pp7bFSZRdIEkQURLY4bzs9cG/iWetCkGJvUjFRuGN7+L8VVTb3oyPRG66vjsT9j7D7rK5ivRF3UVj4H5dl9wXIZFo2CjP/Na/JnZsTKpTSNJgSkShCGUDMXyzorKP8iQRMSWmv6Pi4O78kVfoI2BMWZwQBX9f60jTZy4VCdPe2qzz1Gv+YmfBLDvovT8uW8kg83KnKG6kwdg2vESfQgDoXply+myizwt9qVarVdnGJ6/qD9wEaNFvo5VrDxzDHBeYw==
Received: from [106.10.166.63] by nm11.bullet.mail.sg3.yahoo.com with NNFMP; 23 Jun 2016 12:49:43 -0000
Received: from [106.10.167.153] by tm20.bullet.mail.sg3.yahoo.com with NNFMP; 23 Jun 2016 12:49:43 -0000
Received: from [127.0.0.1] by smtp126.mail.sg3.yahoo.com with NNFMP; 23 Jun 2016 12:49:43 -0000
X-Yahoo-Newman-Id: 560764.18631.bm@smtp126.mail.sg3.yahoo.com
X-Yahoo-Newman-Property: ymail-3
X-YMail-OSG: 0m3V21EVM1ll4FmciCIgqcaWtVOAZq5COmajP0ZIAdS.88e
YJNVJdaZJCZ367euwUwU0puRy.lR96mDtcP5vbPAbaunt_MXe.S4Lw9fHJlW
bT5C2EshA3RzExiH29MfXlPdT85rfo9ToMT0NrX0_Q2wSA.tsZZE6LCm8il4
mwE9KDfxHxpoUWC4OwePVPLEIu8esrX5DCkjWAVujEGyTjNS1avwug6RghHe
17N0A87evnPlLq90Gyr6blnO8DvxcOZ91G3rBbBRVfjAt3SsWG8_g7NFWB9Z
NuYgghrJAzU8TRuN0IduepvGU4WGWb_BA1BIoqvpqHGY_sf_rHG48UwGz7YF
fqGNfvXvKCKLvWlTmTZgHwml55l0KmwNhg8_IurQek2igEMSYHte2R2.vNo9
sXYhgE6Ltff9VyXHZ6SmQau4zSpnMjN07mqsH5m0089joEY1I2Ir1pga5TON
4pS1BScVUEpEIaAV6FhvDM6X4VEGYjtAc.hCoKRyraTSxRyPYZvsdjyCF7E1
PXysnYbgdt.MhozWX_AqGgaAshsuY424IAZeAhQ.Ogfzz7uLTUlZPyywAe9b
.vIrxVAM9AXBE6Y27kaXodi0m6_Jz0nXh0LuP7Z8RwVK7_tjCjw5ar1o570G
G5k2wLSBFhLjs_RedMvHL
X-Yahoo-SMTP: F92PCA2swBBrrWB.kfveU9N3hXCn0EHyzxg-
From: "Mr. Omar Bello" <nabilhakim_73@yahoo.com>
To: "." <.>
X-Mailer: Barca Pro 2.8 (4400) - EXPIRED EVALUATION VERSION
X-URL: http://www.pocomail.com/
Reply-To: omarbello620@yahoo.com
Date: Thu, 23 Jun 2016 13:46:13 +0100
Message-ID: <2016623134613.851697@USER-PC>
Subject: YOUR URGENT RESPONSE NEEDED
Mime-Version: 1.0
Content-Type: text/plain; charset="iso-8859-1"
Content-Transfer-Encoding: quoted-printable
Return-Path: nabilhakim_73@yahoo.com
X-OriginalArrivalTime: 23 Jun 2016 12:49:51.0624 (UTC) FILETIME=[BBBB3880:01D1CD4D]


Dear Friend,

I want to transfer US$20.5 Million to your bank account. The fund belong to our deceased customer who died with his entire family in Iraq War , leaving nobody for the claim and as such, I decided to contact you to enable us claim the fund. Your share is 40% while 60% for me. This transaction is 100% risky free. Contact me for more details on my private email address which is . (omarbello620@yahoo.com)

Thanks,
Omar Bello.
Banque Régionale de Solidarite( BRS),
ouagadougou,Burkina Faso

外贸客户搜索与开发 [rng0@a.dcsqw.net]: 把握商机 成单路上助��一臂之力

x-store-info:4r51+eLowCe79NzwdU2kR3P+ctWZsO+J
Authentication-Results: hotmail.com; spf=pass (sender IP is 103.242.135.120) smtp.mailfrom=rng0@a.dcsqw.net; dkim=none header.d=a.dcsqw.net; x-hmca=pass header.id=rng0@a.dcsqw.net
X-SID-PRA: rng0@a.dcsqw.net
X-AUTH-Result: PASS
X-SID-Result: PASS
X-Message-Status: n:n
X-Message-Delivery: Vj0xLjE7dXM9MDtsPTA7YT0wO0Q9MjtHRD0yO1NDTD02
X-Message-Info: 11chDOWqoTmqhaLdmJvh1qRkQbVek4AlsF+XDtSCigm01A+CwZFoa0Vyqc1kXJaS1Lw4gmjV0oXrxn7uOnEAg0DkxreQw7AqNW46rfX6xufYE7GVqNWU+IPB2rT5qHTCvITds/gC+LR0joPqNdH/4RZmc9gwtsnAnw4009SsSFeRLnEYHw5yj5he755kTOrDXGkFqPQt+xk6N9E/+gsKrXq3JivSSsXLHqiCoH7/NobwPTXzBXPfkQ==
Received: from a.dcsqw.net ([103.242.135.120]) by BAY004-MC3F24.hotmail.com with Microsoft SMTPSVC(7.5.7601.23143);
Thu, 23 Jun 2016 05:49:34 -0700
Received: from 163.125.238.214 (HELO XYZAABBCD); Thu, 23 Jun 2016 20:49:29 +0800
From: "=?GB2312?B?zeLDs7/Nu6fL0cv30+u/qrei?=" <rng0@a.dcsqw.net>
Reply-To: 3163745494@qq.com
To: "dhazuken1977" <dhazuken1977@hotmail.com>
Subject: =?GB2312?B?sNHO1cnMu/ogs8m1pcK3yc/W+sT60rux29auwaY=?=
Message-ID: <201606232049356269990@a.dcsqw.net>
Date: Thu, 23 Jun 2016 20:49:35 +0800
X-Mailer: Foxmail 6, 10, 201, 20 [cn]
MIME-Version: 1.0
Content-Type: multipart/related; boundary="----=fff329_2730_116147489.021548"
X-Priority: 3
Return-Path: rng0@a.dcsqw.net
X-OriginalArrivalTime: 23 Jun 2016 12:49:34.0497 (UTC) FILETIME=[B185D910:01D1CD4D]


&#22269;&#20869;&#228=23;&#22810;&#25968;&#22806;&#36152;&#20225;&#19994;&#23558;&#22806;&#3=6152;&#23458;&#25143;&#24320;&#21457;&#20316;&#20026;&#31532;&#19968;&=#22823;&#38590;&#39064;&#21644;&#25237;&#36164;&#28857;&#12290;=&#32467;&#26524;&#209=60;&#19975;&#29978;&#33267;&#20960;&#21313;&#19975;&#25237;&#36164;&#2=1518;&#65292;&#21457;&#29616;&#33258;&#24049;&#19968;&#30452;&#36319;&=#21516;&#34892;&#22312;&#25250;&#30340;&#20960;&#20010;&#34892;&#19994=;&#20013;&#38388;&#23458;&#25143;&#65292;&#20215;&#26684;&#20302;&#122=89;&#23458;&#25143;&#24544;&#35802;&#24046;&#12290;&#22806;&#36152;&#234=58;&#25143;&#25628;&#32034;&#19982;&#24320;&#21457;&#36719;&#20214;&#2=3545;&#29305;&#23450;&#34892;&#19994;&#65292;&#22312;&#25628;&#32034;&=#24341;&#25806;&#19978;&#38754;&#25628;&#32034;&#26377;&#19968;&#23450=;&#21382;&#21490;&#30340;&#20844;&#21496;&#20225;&#19994;&#32593;&#314=49;&#65292;&#25289;&#21462;&#30446;&#26631;&#23458;&#25143;&#20449;&#2=4687;&#12290;&#32852;&#31995;&#304=95;&#27491;&#39640;&#36136;&#37327;&#30340;&#32456;&#31471;&#23458;&#2=5143;&#65292;&#22806;&#36152;&#23458;&#25143;&#25628;&#32034;&#24110;&=#21161;&#22806;&#36152;&#20013;&#23567;&#20225;&#19994;&#65292;soho&#6=5292;&#22806;&#36152;&#19994;&#21153;&#21592;&#38477;&#20302;&#23458;&=#25143;&#24320;&#21457;&#38376;&#27099;&#65292;&#19981;&#28010;&#36153=;&#26102;&#38388;&#22312;&#22403;&#22334;&#35810;&#30424;&#36523;&#199=78;&#12290;&#19968;&#23398;&#23601;&#20250;&#30340;&#23458;&#25143;&#2=4320;&#21457;&#26041;&#24335;&#31561;&#20320;&#26469;&#20102;&#35299;&=#65281;&#65281;&#65281;&#26377;&#20852;&#36259;&#30340;&#2=6379;&#21451;&#21487;&#20197;&#32852;&#31995;&#25105; QQ&#6=5306;695795168 &#30005;&#35805;&#65306;0755-32801027=iN79diNR8bgKP79 gLQ89eiNR80fKO79

--- ATTACHED ---
image/jpeg: Xxxxxy_9521.jpg"

Mail.Server [swd_sh@swdpu.com.cn]: Your Account Will Be Blocked!

x-store-info:4r51+eLowCe79NzwdU2kR3P+ctWZsO+J
Authentication-Results: hotmail.com; spf=none (sender IP is 222.73.11.179) smtp.mailfrom=swd_sh@swdpu.com.cn; dkim=none header.d=swdpu.com.cn; x-hmca=none header.id=swd_sh@swdpu.com.cn
X-SID-PRA: swd_sh@swdpu.com.cn
X-AUTH-Result: NONE
X-SID-Result: NONE
X-Message-Status: n:n
X-Message-Delivery: Vj0xLjE7dXM9MDtsPTA7YT0wO0Q9MjtHRD0yO1NDTD02
X-Message-Info: 11chDOWqoTm3PJEvAbUAG+hwodYHhKWoErJPQzugtqkVgYLCkMuHgHL2zfF9xHCcyJKQJvCIFsDX0wYG6uXkewEqVa6X9rwVBh/Gk9RSOAIuBoqqn/j2MwjEnHd5KzOjf4wHZtT4Fhq7TPXP5+/RBbAR7fdGdHTpbfQUjx7+YvIaPszAFzQc6KWHex18IFuOPWPQfJYtfe6YX4WSX0mL/PBLOWvHljf4r/24TgBXIyk=
Received: from mail.china-dirs.net ([222.73.11.179]) by SNT004-MC1F29.hotmail.com over TLS secured channel with Microsoft SMTPSVC(7.5.7601.23143);
Thu, 23 Jun 2016 04:10:54 -0700
Received: from ELSEWEDY-SRV01.ELSEWEDY.COM ([86.98.222.185])
by mail.china-dirs.net (IceWarp 10.2.2) with ASMTP id LRG46943
for <dhazuken1977@hotmail.com>; Thu, 23 Jun 2016 19:09:43 +0800
Content-Type: multipart/alternative; boundary="===============1801397415=="
MIME-Version: 1.0
Subject: Your Account Will Be Blocked!
To: dhazuken1977@hotmail.com
From: "Mail.Server" <swd_sh@swdpu.com.cn>
Date: Thu, 23 Jun 2016 15:12:01 +0400
Message-ID: <0cf4dd7e714486e1e11dbc8016f98a92@swdpu.com.cn>
Return-Path: swd_sh@swdpu.com.cn
X-OriginalArrivalTime: 23 Jun 2016 11:10:55.0215 (UTC) FILETIME=[E95B17F0:01D1CD3F]


Dear dhazuken1977@hotmail.com,

we received a request from either you or someone else to terminate your Account. Did you really request us to terminate your [dhazuken1977@hotmail.com]! account?
please if you did not, click CANCEL TERMINATION To cancel the termination request.If not, All files on your mail including (Inbox, Sent, Spam, Trash, Draft) will be deleted and access to your Email address will be Denied.

Regards, Copyright © 2016 All rights reserved.

_________________________ _________________________ __
Please do not reply to this message. Mail sent to this address cannot be answered.

Links go to:

http://maisonnave.com.ar/wp-admin/user/others/?email=dhazuken1977@hotmail.com

hussan saad [e3-administracion@speedy.com.ar]: As-salaam o aliekum

x-store-info:fHNTDlzCF8Nxw6HwcfGQy+S7Ax/lqLSmNphQ3OF+T9E=
Authentication-Results: hotmail.com; spf=pass (sender IP is 208.84.243.181) smtp.mailfrom=e3-administracion@speedy.com.ar; dkim=none header.d=speedy.com.ar; x-hmca=pass header.id=e3-administracion@speedy.com.ar
X-SID-PRA: e3-administracion@speedy.com.ar
X-AUTH-Result: PASS
X-SID-Result: PASS
X-Message-Status: n:n
X-Message-Delivery: Vj0xLjE7dXM9MDtsPTE7YT0wO0Q9MjtHRD0yO1NDTD00
X-Message-Info: ti45PXX+RJiFEw2KMBhRCyeWl7/c3eQIiDAwA/FX0OdX5Kh+9brqL/JnSDMwwUymg8My9OkQH8DvDv1IRRgFRhuowEFdE6GuE2LdpnbCaXuFIoXCQciNJem53MXiml0JvA9f+klmWb7NcHD9UrEs8IOzGjnXL2XTUBNbgoWJ6G46yJdjfSQak8PR6NCz5mM0sJX9ozo43WbSVl0EJlR/nHI/r8Tomc27kBs0/uxk5Fp99bwoORrFcA==
Received: from if04-mail-fb07-mia.mta.terra.com ([208.84.243.181]) by COL004-MC6F28.hotmail.com with Microsoft SMTPSVC(7.5.7601.23143);
Thu, 23 Jun 2016 06:17:29 -0700
Received: from mail-smtp03-mia.tpn.terra.com (unknown [10.235.200.60])
by mail-fb07-mia.tpn.terra.com (Postfix) with ESMTP id 5C3FB18140BC1;
Thu, 23 Jun 2016 13:16:34 +0000 (UTC)
X-Terra-Karma: -2%
X-Terra-Hash: 0884524a7b98603a4695f48b953ff531
Received: from localhost (1v6.terra.com [208.84.242.169])
(authenticated user e3-administracion!speedylm)
by mail-smtp03-mia.tpn.terra.com (Postfix) with ESMTPA id 26A38C001647;
Thu, 23 Jun 2016 13:16:23 +0000 (UTC)
reply-to: hussansaad955@gmail.com
date: Thu, 23 Jun 16 13:16:23 +0000
message-id: <OID_1466687768456648_0e3-administracion@speedy.com.ar>
X-Priority: 3
x-msmail-priority: normal
importance: normal
priority: normal
subject: =?UTF-8?B?QXMtc2FsYWFtIG8gYWxpZWt1bQ==?=
x-origin: 197.239.66.97
from: =?UTF-8?B?aHVzc2FuIHNhYWQ=?= <e3-administracion@speedy.com.ar>
content-type: text/html; charset=utf-8
content-transfer-encoding: QUOTED-PRINTABLE
mime-version: 1.0
to:
X-CMAE-Score: 0
Return-Path: e3-administracion@speedy.com.ar


Dear Friend,
Peace be upon you,

Please kindly pardon me for any inconvenience this letter may cost you because I know it may come to you as a surprise as we have no previous correspondence. I got your contact as I was searching for an assistant in your country, and this is why I decided to appeal to you as a matter of urgency about ($4,700,000.00) Four Million Seven Hundred Thousand United State Dollar. It is an unequivocal fact that we've not met nor communicated before but due to the true revelation that I should share this with you.

My name is Mr Hassan Saad. Accountant of integrated finance of United Bank for Africa UBA here in West Africa, Thus for your indulgence and assistance (morally and financially), i propose a 35% share of the total amount to you after receiving the funds successfully, and i need your assurance of trust that you will not deny me my share once the fund is credited to your bank account, so kindly state your interest by replying immediately and i shall furnish you with details and procedures preceding the transaction, and here is our bank UBA website (www.ubagroup.com) you can study is and get back to me via my personal email address (hussansaad955@gmail.com)
ALLAH BLESS YOU
Mr Hassan Saad

PayPal [CA0E226D-4C3A-4106-832F-BDA2B282971A@undignifiedlyg.megabulkmessage239.com]: Baise-moi ce soir

x-store-info:4r51+eLowCe79NzwdU2kR3P+ctWZsO+J
Authentication-Results: hotmail.com; spf=pass (sender IP is 109.63.134.174) smtp.mailfrom=saccharoidalx@undignifiedlyg.megabulkmessage239.com; dkim=none header.d=ppmail.com; x-hmca=none header.id=noreply@ppmail.com
X-SID-PRA: noreply@ppmail.com
X-AUTH-Result: NONE
X-SID-Result: NONE
X-Message-Status: n:n
X-Message-Delivery: Vj0xLjE7dXM9MDtsPTA7YT0wO0Q9MjtHRD0yO1NDTD02
X-Message-Info: 11chDOWqoTmjqhOzvWWho/vK8oL2x1FIoEm0Tn+r3D4Vy8IHo2wUnhrfADKulrBuAXeaFMykjUDKmj+wGLq0fsQPBf8YhmUliX2XG3k55AkllAY+zTIyU3agg4gLxcrfyPymaDXMUJMu1/WuYXFn3KAfVBCWj7b97beHvj5sv5RiKapGuv7kCEiDYKKyWcOxCDPQm47+UvAUU5mlcFUPwtX9FX6g1C9S3eokcPy1OlhzQdSprrL6EA==
Received: from undignifiedlyg.megabulkmessage239.com ([109.63.134.174]) by BLU004-MC1F1.hotmail.com with Microsoft SMTPSVC(7.5.7601.23143);
Thu, 23 Jun 2016 02:25:19 -0700
DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed;
d=undignifiedlyg.megabulkmessage239.com; s=undignifiedlyg;
h=from:subject:date:message-id:to:mime-version:content-type;
bh=FUnrrhBFDvSz2ZB3uX2UY7HX7xccJalFv0sg9VhgnT0=;
b=G2GuR7ShVyB8ng77y0kwhTAjpXJXKnD5An11+2boH7+rrV4vZESAQ//PMzAjFFxeminIgCdQF0NG
dMsBRZgWj3Jz+pd+yp+2+7A7WY/dV0cjNcQ3kyFEDon/uj8+xsNGXsBWZqF8RqzwlwTKh+Zh3K92
FgNos+OIYydstla6GQs=;
Return-Path: CA0E226D-4C3A-4106-832F-BDA2B282971A@undignifiedlyg.megabulkmessage239.com
Message-ID: <CA0E226D-4C3A-4106-832F-BDA2B282971A@undignifiedlyg.megabulkmessage239.com>
Date: Thu, 23 Jun 2016 12:25:13 +0300
From: PayPal <noreply@ppmail.com>
Subject: Baise-moi ce soir
To: <dhazuken1977@hotmail.com>
MIME-Version: 1.0
Content-Type: multipart/alternative;
boundary="------------NextPart__mmhazkchvipaoqy.86654"
X-OriginalArrivalTime: 23 Jun 2016 09:25:19.0363 (UTC) FILETIME=[28E4CD30:01D1CD31]


NO TEXT

Links go to:

http://sexygirls999.com/photo6/

김영민 [ymkim@ndis.co.kr]: Request for quotation

x-store-info:sbevkl2QZR7OXo7WID5ZcVBK1Phj2jX/
Authentication-Results: hotmail.com; spf=none (sender IP is 211.43.197.70) smtp.mailfrom=ymkim@ndis.co.kr; dkim=none header.d=ndis.co.kr; x-hmca=none header.id=ymkim@ndis.co.kr
X-SID-PRA: ymkim@ndis.co.kr
X-AUTH-Result: NONE
X-SID-Result: NONE
X-Message-Status: n:n
X-Message-Delivery: Vj0xLjE7dXM9MDtsPTA7YT0wO0Q9MTtHRD0xO1NDTD0x
X-Message-Info: NhFq/7gR1vRB54717V1o1JMyxFkaWA53mIB09Z6Uh6c5Gk1NsHABzgH6Se4mOCuWOud32cyzZK7JgK4OvCTaSSSAnLyQHXuhJK4dyQcnDxrEvQxNuaY9DFpJyysY12JWge8y9vzuAk42KQkVoVy6YCZKiL+LA5quDb3oEIygwBnaJGxk6+K8fqKDAdXYT8TE82ejXiMchPJTFB2v2YUNT/7Mi7c/UzJszTej/s/C8HM=
Received: from mail-smail-213.hanmail.net ([211.43.197.70]) by BAY004-MC6F28.hotmail.com over TLS secured channel with Microsoft SMTPSVC(7.5.7601.23143);
Thu, 23 Jun 2016 01:57:06 -0700
Received: from wwl1476.hanmail.net ([114.108.152.91])
by mail-smail-213.hanmail.net (8.13.8/8.9.1) with ESMTP id u5N8uXSf003810;
Thu, 23 Jun 2016 17:56:34 +0900
Received: (from hanadmin@localhost)
by wwl1476.hanmail.net (8.12.9/8.9.1) id u5N8uWQV011994
for <dhazuken1977@hotmail.com>; Thu, 23 Jun 2016 17:56:32 +0900
X-Originating-IP: [169.159.116.182]
From: "=?utf-8?B?6rmA7JiB66+8?=" <ymkim@ndis.co.kr>
Organization:
To: <mspills@hotmail.com>
Subject: Request for quotation
X-Mailer: Daum Web Mailer 1.2
Date: Thu, 23 Jun 2016 17:56:31 +0900 (KST)
Message-Id: <20160623175631.HM.8000000000GsK9P@ind-kym.wwl1476.hanmail.net>
Errors-To: <ind-kym@daum.net>
X-HM-UT: kXjlIvqgPf3xi1ydB95xf//dQGA34i9z
X-HM-FIGURE: kXjlIvqgPf1hSj89G2Pi03QsDz0/GwuB
MIME-Version: 1.0
X-Hanmail-Attr: fc=1
Content-Type: multipart/mixed; boundary="1466672191.DaumWebMailer."
Return-Path: ymkim@ndis.co.kr
X-OriginalArrivalTime: 23 Jun 2016 08:57:06.0828 (UTC) FILETIME=[381074C0:01D1CD2D]


Good Day,
We are in need of the following items in the attached file.
Kindly quote your most competitive offer for same enabling us to proceed further.
Also confirm the lead time.
Waiting for your early reply.

--- ATTACHED ---
text/html: New Order.html

finial@windows-china.com [sales09@eamiltopeasy.top]: Re:Aluminum thermal break windows-No.9 Nice windows

x-store-info:4r51+eLowCe79NzwdU2kRyU+pBy2R9QC1BOpZ3LVvkJVh72cJFiyBCcfBVYzomUNJo1HrqsXjxBBkzX5pwtqpvGbraxHfauVyNd8YN3xPyonIK1+ELlL9QWdJq4g8q/KXsCorGZsUPc=
Authentication-Results: hotmail.com; spf=temperror (sender IP is 101.200.161.88) smtp.mailfrom=sales09@eamiltopeasy.top; dkim=none header.d=windows-china.com; x-hmca=none header.id=finial@windows-china.com
X-SID-PRA: finial@windows-china.com
X-AUTH-Result: NONE
X-SID-Result: NONE
X-Message-Status: n:n
X-Message-Delivery: Vj0xLjE7dXM9MDtsPTA7YT0wO0Q9MjtHRD0yO1NDTD02
X-Message-Info: 2etWe3f/w1emhdx/aseFKOYOD2xK7GoCrJUiNZQekgMutFIjtPSdarMESREmsiIGE7+OlGTKbz4gGADr1acKf93gaGZKU1YpVFWre26M6L7XlypEgAJmYlVcb+lU1sg9icUuvvpjwVyoMgb0n65P2EPeYkt/hgMQ7suoU4LwNL4US54+WKyjGYn1yFZ7wATxPLyLpOviSEdIMtEYDZi241HUjEf6FpbnVrK3hUYPNLWvMtzx3EE9VQ==
Received: from mail.eamiltopeasy.top ([101.200.161.88]) by BAY004-MC5F11.hotmail.com with Microsoft SMTPSVC(7.5.7601.23143);
Thu, 23 Jun 2016 02:18:26 -0700
DKIM-Signature: v=1; a=rsa-sha1; c=relaxed/relaxed; s=e; d=eamiltopeasy.top;
h=From:Subject:To:MIME-Version:Sender:Reply-To:Date:Content-Type:Content-Transfer-Encoding; i=sales09@eamiltopeasy.top;
bh=TuEJ4clZXYeKUs6kzfeuQnGvOMc=;
b=Djv+8BZBd09CTf4LmwO9lPxvIfO7WEAYetTION2Lc1nfsyMb7AZH0s4OBnz3vTzytHDUIO56S5/X
yoMxzJJ8n28fcxP+XjdU8tWqU1mtMjeRTfhqo97clOjSxtulfmCg5z9tYQrR5/uKSOCi9hjJVh8W
auS6JkH6OV4SgiDCSMg=
DomainKey-Signature: a=rsa-sha1; c=nofws; q=dns; s=e; d=eamiltopeasy.top;
b=fZKgxkI94dPX5ejpwvT3FxJ1m6BpUKH+i407hpbNffpz6I+sO0q7lNcdu6YnquoTEmo3nLLpYzUN
2EBVZLuIaUHg9qcEEOWsjokIqSVkobjGxahvLnfLdGaHEO12x2zh6FCFvU81IZT516z/QGCwhbE0
randNx+4zPgPiWpTbRU=;
Received: from HTMC-PC (183.49.3.83) by mail.eamiltopeasy.top id hdekm40e97co for <dhazuken1977@hotmail.com>; Thu, 23 Jun 2016 17:18:25 +0800 (envelope-from <sales09@eamiltopeasy.top>)
From: "finial@windows-china.com" <finial@windows-china.com>
Subject: Re:Aluminum thermal break windows-No.9 Nice windows
To: dhazuken1977@hotmail.com
MIME-Version: 1.0
Sender: sales09@eamiltopeasy.top
Reply-To: finial@windows-china.com
Date: Thu, 23 Jun 2016 17:20:53 +0800
X-Mailer: Foxmail 6, 13, 102, 15 [cn]
Content-Type: text/html; charset="UTF-8"
Content-Transfer-Encoding: base64
Content-Disposition: inline
Return-Path: sales09@eamiltopeasy.top
Message-ID: <BAY004-MC5F11VKi3s1002d8888@BAY004-MC5F11.hotmail.com>
X-OriginalArrivalTime: 23 Jun 2016 09:18:26.0605 (UTC) FILETIME=[32DEEDD0:01D1CD30]


Dear Sir or Madam,

I knew from internet that you are an construction company,
We make high quality aluminum windows,doors for houses and villas.
we wish to cooperate with you.

Our website is:www.windows-china.com, http://htmc.en.alibaba.com

Enclosed our catalogue
for your reference.

Looking forward to hearing from you soon!

Best regards,

Jack

Shenzhen HongTai doors and Windows Co., LTD
Email: finial@windows-china.com

Mohammad Ali [mohammad.ali152@gmail.com]: URGENT REPLY.

x-store-info:4r51+eLowCe79NzwdU2kR3P+ctWZsO+J
Authentication-Results: hotmail.com; spf=pass (sender IP is 209.85.161.196; identity alignment result is pass and alignment mode is relaxed) smtp.mailfrom=mohammad.ali152@gmail.com; dkim=pass (identity alignment result is pass and alignment mode is relaxed) header.d=gmail.com; x-hmca=pass header.id=mohammad.ali152@gmail.com
X-SID-PRA: mohammad.ali152@gmail.com
X-AUTH-Result: PASS
X-SID-Result: PASS
X-Message-Status: n:n
X-Message-Delivery: Vj0xLjE7dXM9MDtsPTA7YT0wO0Q9MjtHRD0yO1NDTD00
X-Message-Info: o9rlR4nWDTdAvwKKkW+ebsbIqWqvbmHQepmsmDIJfnrMk9N7siaelqm7Tj6+Y8ybQk7FhdUI7lKWX+bJjf/mTGSaHZFnIPqcsISufGQhoRbzRt/de9Qp0cpRmVF4YVBEqknDr/P8X1tI6eqMsOjIvXVa2nSM0KeZN0g7DK7eQ+G+hv4NKRP45bYquunJAtS4VqhGn2koKuYAGdYVCvK3ERi2M2PjHhVWiJN8O/n4BZhHUKvDXemqsg==
Received: from mail-yw0-f196.google.com ([209.85.161.196]) by COL004-MC2F35.hotmail.com over TLS secured channel with Microsoft SMTPSVC(7.5.7601.23143);
Thu, 23 Jun 2016 02:23:09 -0700
Received: by mail-yw0-f196.google.com with SMTP id f75so9917497ywb.3
for <dhazuken1977@hotmail.com>; Thu, 23 Jun 2016 02:23:08 -0700 (PDT)
DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed;
d=gmail.com; s=20120113;
h=mime-version:reply-to:from:date:message-id:subject:to;
bh=kYUnijhhQwcse2BtkCALvCyZqnwHIuMq275MHWKAHsM=;
b=JeTSnwx6DwuwlIe1uwkM05wE35D6y5pHwsVs3JyjCc3Csbfpr6cd8tIQc3vqr+vWb4
QokbnHFwB8swU7ZJhmq6F5mla1iF0ROB4cZHhkvIsWxIpGzMDBvEU4rr8cI0vJ0aHTlz
efSzy1O/TnLP3SxcA9yLarrXdq8/12nHCJNtHEBgUG5RmWd4D0Ai55Zcw7/0gXRCUue6
KoVRy96B1rhwjNbML2gNa/dnRfQC1G+QcwOzbFPlsq7JiCKF0gVuASmH7P3vPE942rV/
4o2Xe9oq4k2ChBWwKTqtJfnFWDcOso+xU9utgec0O3UuMFMYgV0/FLhLJnrffcS9zOcw
0Shg==
X-Google-DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed;
d=1e100.net; s=20130820;
h=x-gm-message-state:mime-version:reply-to:from:date:message-id
:subject:to;
bh=kYUnijhhQwcse2BtkCALvCyZqnwHIuMq275MHWKAHsM=;
b=SqZVcN2fJL3fkbza+/HaiA4StB18Z7jo8yoYhAepimcf0D1PD+w0AXXoj0d57mvqBY
P9WCVvPAuMws6JC8L8/ROIwJ1BsBhGZkRfChh9gKO9IfCASOvD2OgvtxO+QO2NEAsbk5
A9kcSyNfZryyGZVdBDMfswcAS89Mng8FCQmkYJiJwZI4ZtXmHvEs4eEf9QqAj6+3Ngxq
XgJDQgkG4abU92WceMB4xz6JCWv7ba5sEe+DOjl+9whnN8/Z5k3ERiGtn2+VdnIwzH6L
RjOMkXbAbeL5F0Xw6NCQXo05NajC3jlU7fF21WOXln5mWM/ULlZ9D/Ir0ejRgTzezZ6b
bwFg==
X-Gm-Message-State: ALyK8tIc2Tw3Q51+TVfDNWLtPZvOg0L6o5sQg48oUZNuLiULu570FqXnjLlrEPIjIzPr6vQ5OFDfzNqTR+i2hQ==
X-Received: by 10.129.39.76 with SMTP id n73mr18550233ywn.294.1466673788610;
Thu, 23 Jun 2016 02:23:08 -0700 (PDT)
MIME-Version: 1.0
Received: by 10.13.234.19 with HTTP; Thu, 23 Jun 2016 02:23:08 -0700 (PDT)
Reply-To: mohammad.ali15215@gmail.com
From: Mohammad Ali <mohammad.ali152@gmail.com>
Date: Thu, 23 Jun 2016 11:23:08 +0200
Message-ID: <CAEpsUMjQL1iBGKB32HLCU0YMW61y2GjWPhs+eQ9vuR5Ja5B8xA@mail.gmail.com>
Subject: URGENT REPLY.
To: undisclosed-recipients:;
Content-Type: text/plain; charset=UTF-8
Bcc: dhazuken1977@hotmail.com
Return-Path: mohammad.ali152@gmail.com
X-OriginalArrivalTime: 23 Jun 2016 09:23:09.0226 (UTC) FILETIME=[DB5378A0:01D1CD30]


Greetings My Dear Friend,

Before I introduce myself, I wish to inform you that this letter is
not a hoax mail and I urge you to treat it serious. This letter must
come to you as a big surprise, but I believe it is only a day that
people meet and become great friends and business partners. Please I
want you to read this letter very carefully and I must apologize for
barging this message into your mail box without any formal
introduction due to the urgency and confidentiality of this business
and I know that this message will come to you as a surprise. Please
this is not a joke and I will not like you to joke with it ok,

With due respect to your person and much sincerity of purpose, I make
this contact with you as I believe that you can be of great assistance
to me. My name is Mr Mohammad Ali, from Burkina Faso, West Africa. I
work in African Development Bank (ADB) as telex manager, please see
this as a confidential message and do not reveal it to another person
and let me know whether you can be of assistance regarding my proposal
below because it is top secret.

I am about to retire from active Banking service to start a new life
but I am skeptical to reveal this particular secret to a stranger. You
must assure me that everything will be handled confidentially because
we are not going to suffer again in life. It has been 10 years now
that most of the greedy African Politicians used our bank to launder
money overseas through the help of their Political advisers. Most of
the funds which they transferred out of the shores of Africa were gold

and oil money that was supposed to have been used to develop the
continent. Their Political advisers always inflated the amounts before
transferring to foreign accounts, so I also used the opportunity to
divert part of the funds hence I am aware that there is no official
trace of how much was transferred as all the accounts used for such
transfers were being closed after transfer. I acted as the Bank
Officer to most of the politicians and when I discovered that they
were using me to succeed in their greedy act; I also cleaned some of
their banking records from the Bank files and no one cared to ask me
because the money was too much for them to control. They laundered
over $5billion Dollars during the process.

Before I send this message to you, I have already diverted
($17.4million Dollars) to an escrow account belonging to no one in the
bank. The bank is anxious now to know who the beneficiary to the funds
is because they have made a lot of profits with the funds. It is more
than Eight years now and most of the politicians are no longer using
our bank to transfer funds overseas. The ($17.4million Dollars) has
been laying waste in our bank and I don want to retire from the bank
without transferring the funds to a foreign account to enable me share
the proceeds with the receiver (a foreigner). The money will be shared
60% for me and 40% for you. There is no one coming to ask you about
the funds because I secured everything. I only want you to assist me
by providing a reliable bank account where the funds can be
transferred.

You are not to face any difficulties or legal implications as I am
going to handle the transfer personally. If you are capable of
receiving the funds, do let me know immediately to enable me give you
a detailed information on what to do. For me, I have not stolen the
money from anyone because the other people that took the whole money
did not face any problems. This is my chance to grab my own life
opportunity but you must keep the details of the funds secret to avoid
any leakages as no one in the bank knows about the my plans.

Please get back to me if you are interested and capable to handle this
project, I shall intimate you on what to do when I hear from your
confirmation and acceptance. If you are capable of being my trusted
associate, do declare your consent to me. I am looking forward to hear
from you immediately for further information.

Thanks with my best regards.
Mr Mohammad Ali,
Telex Manager
African Development Bank (ADB)
Burkina Faso.

YK [yaoketradingyl@163.com]: Re:

x-store-info:J++/JTCzmObr++wNraA4Pa4f5Xd6uensydyekesGC2M=
Authentication-Results: hotmail.com; spf=pass (sender IP is 220.181.13.11) smtp.mailfrom=yaoketradingyl@163.com; dkim=pass header.d=163.com; x-hmca=pass header.id=yaoketradingyl@163.com
X-SID-PRA: yaoketradingyl@163.com
X-AUTH-Result: PASS
X-SID-Result: PASS
X-Message-Status: n:n
X-Message-Delivery: Vj0xLjE7dXM9MDtsPTE7YT0wO0Q9MTtHRD0xO1NDTD0w
X-Message-Info: MfEgptJWZFhCBfB7oP23nLJ8Ttai74LkgZaVCy3aRKVsa7MIkphK+0Anvd/FIwTNo4jHeAbiUmtOG+tW8SH+FPmo4Tyx0vO3MYtUnOcnH2JsECAEaX8LbfQNN/79h7QjV9yd2YJHf1HpM42qzuInEI5PQ+Je3ueOFrlHuPBPHc4nb9OJUty/g28JUY1XnJyGXVgU/7BkWYXNxb4BpjDP2KqkkeHtb0sB6LpcTSOK51I=
Received: from m13-11.163.com ([220.181.13.11]) by COL004-MC4F47.hotmail.com with Microsoft SMTPSVC(7.5.7601.23143);
Wed, 22 Jun 2016 23:57:21 -0700
DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=163.com;
s=s110527; h=Date:From:Subject:MIME-Version:Message-ID; bh=au8iz
2OrEPa18v6ej6zsivgadkcIHLYp90f9/P79kow=; b=MP15aTQW6R2M8vEZbpHDn
RwelBNkxmmnDn2U33Fiytrhmjm0oTUJhe8gIG5tNynQv7QoQUAohtnWK9jU7tWel
zotXVXA10y9sQnnFH463VdiGQskjY6UubJmj3pfDTagg9IMkhW/D48MdjTDkdG8G
dST2M2CTJiPC0WNi+w2qjY=
Received: from yaoketradingyl$163.com ( [1.85.11.115] ) by
ajax-webmail-wmsvr11 (Coremail) ; Thu, 23 Jun 2016 14:56:13 +0800 (CST)
X-Originating-IP: [1.85.11.115]
Date: Thu, 23 Jun 2016 14:56:13 +0800 (CST)
From: YK <yaoketradingyl@163.com>
To: carine_domingos@hotmail.com, tassia_helena@yahoo.com.br,
firlingmamma@gmail.com, dziaugsmass@gmail.com, mudite12@e-apollo.lv,
alina_cerasella@yahoo.com, dv-zaprudje@zg.t-com.hr,
info@ffshoppen.nl, minsen@skynet.be, dhazuken1977@hotmail.com,
pgg@landau.ac.ru, barnita@gmail.com, babdelali@hotmail.com,
erwan_sophie@yahoo.fr, abbasb93@hotmail.fr, yesman@club-internet.fr
Subject: Re:
X-Priority: 3
X-Mailer: Coremail Webmail Server Version SP_ntes V3.5 build
20160420(83524.8626) Copyright (c) 2002-2016 www.mailtech.cn 163com
X-CM-CTRLDATA: X+xCU2Zvb3Rlcl9odG09MzY2ODA6NTY=
Content-Type: multipart/alternative;
boundary="----=_Part_99219_1040810931.1466664973609"
MIME-Version: 1.0
Message-ID: <5e968e72.6386.1557c0b7529.Coremail.yaoketradingyl@163.com>
X-Coremail-Locale: zh_CN
X-CM-TRANSID:C8GowADHgxEPiGtXsVoVAA--.64290W
X-CM-SenderInfo: 51dryvxwudvxhqj1zqqrwthudrp/1tbiNRmQi1SIOYv0wgAHso
X-Coremail-Antispam: 1U5529EdanIXcx71UUUUU7vcSsGvfC2KfnxnUU==
Return-Path: yaoketradingyl@163.com
X-OriginalArrivalTime: 23 Jun 2016 06:57:21.0557 (UTC) FILETIME=[7D4F1C50:01D1CD1C]


Dear Sir,

We would like to order the Baby Products of you.
If you can provide this kind of product, please provide us the catalog and price list.
Hoping your early reply.

Sincerely,
Honglin

YK Imp&Exp CO.,LTD

Eagles Height int'l Co., Ltd [ito@kaiyukan.com]: [SPAM] Business Enquiry.

x-store-info:4r51+eLowCe79NzwdU2kR3P+ctWZsO+J
Authentication-Results: hotmail.com; spf=pass (sender IP is 210.252.69.98) smtp.mailfrom=ito@kaiyukan.com; dkim=none header.d=kaiyukan.com; x-hmca=pass header.id=ito@kaiyukan.com
X-SID-PRA: ito@kaiyukan.com
X-AUTH-Result: PASS
X-SID-Result: PASS
X-Message-Status: n:n
X-Message-Delivery: Vj0xLjE7dXM9MDtsPTA7YT0wO0Q9MjtHRD0yO1NDTD00
X-Message-Info: isY2VobhFN8c+2fNI+GDRj7zHnbBP6aJRdMs4h+B4RIbwc9lFxg5Ug2HqUSJVjGQZ6IASIfLVPh3fTnKXz/4RweH5g/idEPM5/ACxKd3wFmf1qfpGIV8s5XY3cFJYsmV+9k76XdT+KF4mgDBeOMxkE/PPRA/WO4w/yY7bUZRHGdJL4yEWNojrc4/AjK5D8kG+EtdjBj58tQCytrHX2c9hD+pgERymTXpBWy+1bfVNyYNRtqwuwQQYA==
Received: from scarlet-elephant-106ca777226b086e.znlc.jp ([210.252.69.98]) by COL004-MC4F28.hotmail.com over TLS secured channel with Microsoft SMTPSVC(7.5.7601.23143);
Thu, 23 Jun 2016 00:08:23 -0700
Received: from User (unknown [173.242.112.121])
by scarlet-elephant-106ca777226b086e.znlc.jp (Postfix) with ESMTPA id 857DD92C1;
Thu, 23 Jun 2016 16:08:10 +0900 (JST)
Reply-To: <egleaheightintldt@163.com>
From: "Eagles Height int'l Co., Ltd"<ito@kaiyukan.com>
Subject: [SPAM] Business Enquiry.
Date: Thu, 23 Jun 2016 00:08:21 -0700
MIME-Version: 1.0
Content-Type: text/html;
charset="Windows-1251"
Content-Transfer-Encoding: 7bit
X-Priority: 3
X-MSMail-Priority: Normal
X-Mailer: Microsoft Outlook Express 6.00.2600.0000
X-MimeOLE: Produced By Microsoft MimeOLE V6.00.2600.0000
X-Antivirus: Dr.Web (R) for Unix mail servers drweb plugin ver.6.0.2.8
X-Antivirus-Code: 0x100000
X-Drweb-SpamState: yes
X-Drweb-SpamScore: 840
X-DrWeb-SpamReason: gggruggvucftvghtrhhoucdtuddrfeeltddrtdehucetufdoteggodetrfcurfhrohhfihhlvgemuceonhhonhgvqeenuceurghilhhouhhtmecupfdsteenucfjughrucdvfedtucdlvddttddmnehmihhsshhinhhgucfvqfcufhhivghlugculdeftddmnegopfhokfffucdluddtmdennddoufgtrghmhidqofhonhgvhidqvghnucdlfedttddmnednvehhihhnrgdqkfhnughushhtrhihucdlfedttddm
Bcc:
Return-Path: ito@kaiyukan.com
Message-ID: <COL004-MC4F28tXsL1c00193645@COL004-MC4F28.hotmail.com>
X-OriginalArrivalTime: 23 Jun 2016 07:08:24.0753 (UTC) FILETIME=[089ACA10:01D1CD1E]


Dear Sir / Madam,

I am Andrea Madison from EAGLES HEIGHT INTERNATIINAL CO., LTD based in the USA.

I got your contact through my research on web,

I believe you are a registered manufacturer / supplier.

Is your price list affected by the exchange rate?

Do you have a good shipper that will handle the shipping?

Please update us with your payment terms?

We are looking for a trusted supplier who can be supplying us constantly based on the quality of products with competitive prices.

Please send your quotation along with your lead times and minimum order and also mention your saver payment terms

as we prefer T/T terms on payment and also let us know if you have made any supply to USA and CANADA or do have any agent in USA

kindly,let us know their contact details.

Please note:Your quotes should indicate the following as below:

Your Delivery Time:

Make and Origin:

Packing Details:

Catalog:

ISO Certificate/s if you any for to gurantee our trust on your quality.

If you need more clarification, kindly inform us.

Your quick response is highly appreciated.

Best Regards

Andrea Madison.

International Department, Estimation Purchase & Procurement

officer.

1200 G Street NW., Suite 800

Washington DC 20005 USA.

+17712103709

Business Hours: 9 : 00 am to 12:00 pm, 4:30 pm to 9.30 pm (Saturdays to Friday).

Sky Tour [mmn07+bncBCYPJZ74BMIOXL5OXMCRUBBAPNQP6@googlegroups.com]: AMAZING SUMMER HOLIDAY PACKAGES

x-store-info:fHNTDlzCF8Nxw6HwcfGQy1tq5E+Kj5gW5NXj5Yk7sZ9+y+evB25XXaW9ZB3RBCh9jkmbVcgwnpxBEqYeORUlZOXDNdUnvVPbxYpuSPjLiy9NbV93OO9XJO0TqcqJV/PyEg2IIk4ci1kM84tPLuGcDg==
Authentication-Results: hotmail.com; spf=pass (sender IP is 74.125.82.55; identity alignment result is fail and alignment mode is relaxed) smtp.mailfrom=mmn07+bncBCYPJZ74BMIOXL5OXMCRUBBAPNQP6@googlegroups.com; dkim=pass (identity alignment result is pass and alignment mode is relaxed) header.d=gmail.com; dkim=pass header.d=googlegroups.com; x-hmca=pass header.id=mmn07@googlegroups.com
X-SID-PRA: mmn07@googlegroups.com
X-AUTH-Result: PASS
X-SID-Result: PASS
X-Message-Status: n:n
X-Message-Delivery: Vj0xLjE7dXM9MDtsPTE7YT0wO0Q9MjtHRD0yO1NDTD00
X-Message-Info: UyR21SRIUOzyg23i2PKPNyxFLO/SzvwPSuCS3Q5DcU9+OOqPv7RARX5Qf1q4YCmmnv5SZP+xDAvvXbUnAAb8C1j/16sb005W6I0/KPOjAEUWadLIw9JGDOGAHO0N88sXDkPS2BhIp4oujhP0Cic2Rbw1mj01Cbm350XzegvAEf6fjHEHwGrsuazlXkSuuPsHNAC7i0LWsGnhwSMpZdg4izn+XAhoM+YMS1E6i69Hq2M=
Received: from mail-wm0-f55.google.com ([74.125.82.55]) by BAY004-MC2F3.hotmail.com over TLS secured channel with Microsoft SMTPSVC(7.5.7601.23143);
Thu, 23 Jun 2016 01:04:00 -0700
Received: by mail-wm0-f55.google.com with SMTP id c82sf6619219wme.1;
Thu, 23 Jun 2016 01:03:59 -0700 (PDT)
DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed;
d=googlegroups.com; s=20120806;
h=sender:from:to:cc:subject:date:message-id:mime-version:importance
:content-language:thread-index:x-original-sender
:x-original-authentication-results:precedence:mailing-list:list-id
:x-spam-checked-in-group:list-post:list-help:list-archive
:list-subscribe:list-unsubscribe;
bh=hYHJMTxAnWd4rlakE/jR9dl2YyPtqdEvxqT7kj4Dez0=;
b=U8bWTODtoecc6LMfajSaVIeCqjUlZ+hzazG9T6QRA/LoMwlLpz/wsOh6UB2fPc/5VX
rcRDoXuPOOyjTKXt157+EfIn/kgkH6lF4m55QDtLnWb2N2wg2DWHQ21HiCae7iZuEoQI
4xsdaNVVhhsf+amdGMlcfNOQrvrsrl2Iiz9mRSXREwd11Y88E1csIs/0OxHvOWG1RbxL
8g3gwr9HUf3Qsp4KF8+1SK9D8l43FLz/5p4Lcs7UZj4PKhRGxTmejZuXcfxJHw7FexKw
lepNzJzxhJGMagEKVedYrsxG2olqRH7GtGikEwkvHkLkIX77ICfnMadKZwTc5W1MP1bb
loxw==
DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed;
d=gmail.com; s=20120113;
h=from:to:cc:subject:date:message-id:mime-version:importance
:content-language:thread-index:x-original-sender
:x-original-authentication-results:precedence:mailing-list:list-id
:x-spam-checked-in-group:list-post:list-help:list-archive
:list-subscribe:list-unsubscribe;
bh=hYHJMTxAnWd4rlakE/jR9dl2YyPtqdEvxqT7kj4Dez0=;
b=KmfB1BetdP6wv8pq79zFsHwIQYfgitUViNlCe8Lp2BFulyHr5dWNoWQEZjM3KKybe1
HnghfqRzEmY0+2kUA9vHBQQS+tZQKDyLLUVopEC6Xthq1YSnqMjknqF7xlC8omh1N20/
cCZLM+rGIOFI8R+ETuYXqrQeIpamr+TxhqFkCAcjZjSyrRtvKkpMUUn/y5nqB83RpIDY
HHakwIUbrs3s1PyyoGwCiJal2vUFhMhM+z1gS+o7bf0saQv44mIDk8IQWPA5GA+ddk9y
0UsqYmOae6QvtT9d380dsOTkHwwQe/dLOvnfOXH/q8RaQF1yK6G/1mc1GxJK8Vt1PMMK
fCag==
X-Google-DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed;
d=1e100.net; s=20130820;
h=sender:x-gm-message-state:from:to:cc:subject:date:message-id
:mime-version:importance:content-language:thread-index
:x-original-sender:x-original-authentication-results:precedence
:mailing-list:list-id:x-spam-checked-in-group:list-post:list-help
:list-archive:list-subscribe:list-unsubscribe;
bh=hYHJMTxAnWd4rlakE/jR9dl2YyPtqdEvxqT7kj4Dez0=;
b=WWG43QD1ZziHiGQWorLMXx7DvaUC9g3oZtCWHjhfyuH4Jxc925+Ta1bHV1m7E/tWQ/
9pqR5fzWoqTLxNTWCr/JdjXdzrViKG+IC9BdorNte/wK2Yg9F+/GKav8lYyBQFFoeGDf
9quQUs+DmKbGSO1LxW9v06qzXCA+aLXk0ZFdBvmijMaNgitV0uYBj/GR2drGKBoL1yiT
vWpRFyVnDZCWhwVAimFu3Hkf/BxTO57Kyfcva8gI+7DVR9feSwfBxjEqorM9Dm4pijTn
mcKdwiifnoWptMqJHaJf+csC1PfyffOkO/Zq4aoJJvoWqE7r6QQ3FrQjXufI8RL+3ipr
VBrA==
Sender: mmn07@googlegroups.com
X-Gm-Message-State: ALyK8tJtM5n8T6JdBdC8ekWxg/WueX5Embp3fzeZhCKgaH2SJ0c4g5vUvUKQ9vO43mG5Zw==
X-Received: by 10.28.157.1 with SMTP id g1mr90178wme.4.1466669038027;
Thu, 23 Jun 2016 01:03:58 -0700 (PDT)
X-BeenThere: mmn07@googlegroups.com
Received: by 10.28.20.193 with SMTP id 184ls550737wmu.9.gmail; Thu, 23 Jun
2016 01:03:55 -0700 (PDT)
X-Received: by 10.194.115.202 with SMTP id jq10mr313909wjb.4.1466669035143;
Thu, 23 Jun 2016 01:03:55 -0700 (PDT)
Received: from mail-wm0-x241.google.com (mail-wm0-x241.google.com. [2a00:1450:400c:c09::241])
by gmr-mx.google.com with ESMTPS id x70si190890wmf.1.2016.06.23.01.03.54
(version=TLS1_2 cipher=ECDHE-RSA-AES128-GCM-SHA256 bits=128/128);
Thu, 23 Jun 2016 01:03:54 -0700 (PDT)
Received-SPF: pass (google.com: domain of mmnp7865@gmail.com designates 2a00:1450:400c:c09::241 as permitted sender) client-ip=2a00:1450:400c:c09::241;
Received: by mail-wm0-x241.google.com with SMTP id a66so8551232wme.2;
Thu, 23 Jun 2016 01:03:54 -0700 (PDT)
X-Received: by 10.28.169.66 with SMTP id s63mr12609478wme.87.1466669034381;
Thu, 23 Jun 2016 01:03:54 -0700 (PDT)
Received: from newlifenetwork ([113.203.184.86])
by smtp.gmail.com with ESMTPSA id kd7sm3072032wjc.33.2016.06.23.01.03.34
(version=TLS1 cipher=ECDHE-RSA-AES128-SHA bits=128/128);
Thu, 23 Jun 2016 01:03:53 -0700 (PDT)
From: Sky Tour <mmnp7865@gmail.com>
To: <info@skytourandtravels.com.pk>
Cc: <mmnp7866@gmail.com>
Subject: AMAZING SUMMER HOLIDAY PACKAGES
Date: Thu, 23 Jun 2016 13:03:31 +0500
Message-ID: <00ae01d1cd25$c0afb640$420f22c0$@com>
MIME-Version: 1.0
Content-Type: multipart/related;
boundary="----=_NextPart_000_00AF_01D1CD4F.A985BE40"
X-Priority: 1 (Highest)
X-MSMail-Priority: High
X-Mailer: Microsoft Office Outlook 12.0
Importance: High
Content-language: en-us
Thread-Index: AdGfiQ6rPIBXg/8QRD+/DYGXzlGM6QAx3BCwADEmzqAANMz/gAAwkjZgAGYh1CAAL6tTEAAzNS1QADNBR3AAMdYyEAAySotQAGMWNPAAAB7egAAx8h5AADLH5OAAMiqncAAz4dEwADwBREAAWECvUAAzW/8wADI0v2AAAq8oEAA31gLQACpbgfAAmzfv0AAt+IPQACzXFHAAOp7NoAAylTzAAJdLFmAANg4nEAAsdKhAADKzNBAAMZ8EQAA1LMYQAGkRtUAAKT8BoAAyoiCAADDK/oAAMjuYUAAyt8AgAGaxCvAAMUMkcAA17M8QAWaD0SAAK1LyEAAAnAkw
x-cr-hashedpuzzle: Dny7 DqwB ELPt Em5F FI43 FoFa G7+N Il1l KJb/ KWkG LIse O1Ex Smsh UhBi VOsG V2SJ;2;aQBuAGYAbwBAAHMAawB5AHQAbwB1AHIAYQBuAGQAdAByAGEAdgBlAGwAcwAuAGMAbwBtAC4AcABrADsAbQBtAG4AcAA3ADgANgA2AEAAZwBtAGEAaQBsAC4AYwBvAG0A;Sosha1_v1;7;{034A0350-2E4D-49AC-BAFB-E8CE3F15F423};bQBtAG4AcAA3ADgANgA1AEAAZwBtAGEAaQBsAC4AYwBvAG0A;Thu, 23 Jun 2016 08:03:20 GMT;QQBNAEEAWgBJAE4ARwAgAFMAVQBNAE0ARQBSACAASABPAEwASQBEAEEAWQAgAFAAQQBDAEsAQQBHAEUAUwA=
x-cr-puzzleid: {034A0350-2E4D-49AC-BAFB-E8CE3F15F423}
X-Antivirus: avast! (VPS 160622-2, 06/22/2016), Outbound message
X-Antivirus-Status: Clean
X-Original-Sender: mmnp7865@gmail.com
X-Original-Authentication-Results: gmr-mx.google.com; dkim=pass
header.i=@gmail.com; spf=pass (google.com: domain of mmnp7865@gmail.com
designates 2a00:1450:400c:c09::241 as permitted sender) smtp.mailfrom=mmnp7865@gmail.com;
dmarc=pass (p=NONE dis=NONE) header.from=gmail.com
Precedence: list
Mailing-list: list mmn07@googlegroups.com; contact mmn07+owners@googlegroups.com
List-ID: <mmn07.googlegroups.com>
X-Spam-Checked-In-Group: mmn07@googlegroups.com
X-Google-Group-Id: 430600398166
List-Post: <https://groups.google.com/group/mmn07/post>, <mailto:mmn07@googlegroups.com>
List-Help: <https://groups.google.com/support/>, <mailto:mmn07+help@googlegroups.com>
List-Archive: <https://groups.google.com/group/mmn07
List-Subscribe: <https://groups.google.com/group/mmn07/subscribe>, <mailto:mmn07+subscribe@googlegroups.com>
List-Unsubscribe: <mailto:googlegroups-manage+430600398166+unsubscribe@googlegroups.com>,
<https://groups.google.com/group/mmn07/subscribe>
Return-Path: mmn07+bncBCYPJZ74BMIOXL5OXMCRUBBAPNQP6@googlegroups.com
X-OriginalArrivalTime: 23 Jun 2016 08:04:00.0723 (UTC) FILETIME=[CCFF6A30:01D1CD25]


Sky Tour2.jpg

AMAZING SUMMER HOLIDAY PACKAGES FOR

DUBAI, THAILAND, SINGAPORE, MALAYSIA

FOR MORE INFORMATION CALL

SKY TOUR AND TRAVELS

SUMMER HOLIDAY

EXPLORE DUBAI

6 DAYS PKR 110,000 (Per Person)

EXPLORE THAILAND, MALAYSIA, SINGAPORE

PKR 175,000 (Per Person)

Sky Tour and Travels

Contact Numbers:

0322-3593046

0321-2027951

021-34535890-93

Website: www.skytourandtravels.com.pk

Email: info@skytourandtravels.com.pk

============================================================================
==
Call Now to Promote Your Business & Increase Your Profitability Today.

0321 218 48 88
0346 002 56 24

0343 243 50 92

0315 850 42 46

0213 481 23 61

Registered & Recognized by Government of Pakistan to carry out:

SMS, Branded SMS, Email, Social Media, Indoor / Outdoor, Cable / TV /
Digital / Print Media, Event, Online Marketing, Modeling & Brand Management

============================================================================

You received this email in response to your subscription request.

If you do not want to receive career opportunities, business offers, events
/ discount & deals offers

then you can unsubscribe by forwarding this email to mmnp7866@gmail.com

--
You received this message because you are subscribed to the Google Groups "Branded Network 07" group.
To unsubscribe from this group and stop receiving emails from it, send an email to mmn07+unsubscribe@googlegroups.com.
For more options, visit https://groups.google.com/d/optout.

--- ATTACHED ---
image/jpeg: image002.jpg

Links go to:

http://www.skytourandtravels.com.pk

https://groups.google.com/d/optout

David Pickard [scooterman@cableone.net]

x-store-info:fHNTDlzCF8Nxw6HwcfGQy+S7Ax/lqLSmNphQ3OF+T9E=
Authentication-Results: hotmail.com; spf=pass (sender IP is 64.8.70.48) smtp.mailfrom=scooterman@cableone.net; dkim=none header.d=cableone.net; x-hmca=pass header.id=scooterman@cableone.net
X-SID-PRA: scooterman@cableone.net
X-AUTH-Result: PASS
X-SID-Result: PASS
X-Message-Status: n:n
X-Message-Delivery: Vj0xLjE7dXM9MDtsPTE7YT0wO0Q9MjtHRD0yO1NDTD00
X-Message-Info: 11chDOWqoTmN4oB/H6XCm/RFx9O80H4XcQZBu51P9AP4eVFpxMA6FuSt4jAwrZbXpRewWYyUidKJZhYcF0FJMa8SBR7d3GTp7qSymWVUvjEItF81DAuiwpy1UWwOhH5fHICd0c4anR32tc19CIdZPbExvuk/LU5iIVgEeZDERimPnx4MzorBlmwdQoJ9IK4jHshtRWd+Jv3pCrruZvEcQFHKZSRsFlUHs0b3CnOwTYqO51MfpSQIuw==
Received: from mail.cableone.net ([64.8.70.48]) by SNT004-MC4F16.hotmail.com over TLS secured channel with Microsoft SMTPSVC(7.5.7601.23143);
Thu, 23 Jun 2016 00:07:12 -0700
Return-Path: <scooterman@cableone.net>
X_CMAE_Category: , ,
X-CNFS-Analysis: v=2.2 cv=YYT/3EZf c=1 sm=1 tr=0 a=yTx995c07N0nKuY1Sm/bcQ==:117 a=9cW_t1CCXrUA:10 a=FKkrIqjQGGEA:10 a=sWbodZrWltYA:10 a=pGLkceISAAAA:8 a=OsM18fDkg3ptYne8-O4A:9 a=U7KBPT6XCHMtIyQ_:21 a=mVf0FmxC70ITD4jb:21 a=TVWcnawnph0A:10 a=_W_S_7VecoQA:10 a=6kGIvZw6iX1k4Y-7sg4_:22
X-CM-Score: 0
X-Scanned-by: Cloudmark Authority Engine
X-Authed-Username: c2Nvb3Rlcm1hbkBjYWJsZW9uZS5uZXQ=
Received: from [10.203.0.112] ([10.203.0.112:49386] helo=md12.cableone.synacor.com)
by mail.cableone.net (envelope-from <scooterman@cableone.net>)
(ecelerity 3.6.6.45965 r(Core:3.6.6.0)) with ESMTP
id A0/20-03876-99A8B675; Thu, 23 Jun 2016 03:07:08 -0400
Date: Thu, 23 Jun 2016 03:07:05 -0400 (EDT)
From: David Pickard <scooterman@cableone.net>
Message-ID: <369196974.5993288.1466665625001.JavaMail.zimbra@cableone.net>
Subject:
MIME-Version: 1.0
Content-Type: multipart/alternative;
boundary="----=_Part_5993287_162932757.1466665624999"
X-Originating-IP: [10.35.6.30]
X-Mailer: Zimbra 8.0.7_GA_6021 (ZimbraWebClient - FF47 (Win)/8.0.7_GA_6021)
Thread-Topic:
Thread-Index: 8dVhshBbuAzjnpLggA7bD2WzuVxFKQ==
Bcc:
X-OriginalArrivalTime: 23 Jun 2016 07:07:12.0039 (UTC) FILETIME=[DD438370:01D1CD1D]


Hello,

This is a personal email directed to you for your consideration alone, I request that it remain and be treated as such only. Please bear with me for now and do not ask my name. I am a banker with Bank Austria the biggest bank located in Austria. I have an interesting business proposal for you that will be of immense benefit to both of us. Although this may be hard for you to believe, we stand to gain 7.2 million Euros between us in a matter of days. Please grant me the benefit of doubt and hear me out. I need you to signify your interest by replying to this Email:ramonchmidt1@gmail.com

Most importantly, I will need you to promise to keep whatever you learn from me between us even if you decide not to go along with me. I will make more details available to you on receipt of a positive response from you.

Leo [Leo@roller.net]: conveyor roller

x-store-info:4r51+eLowCe79NzwdU2kR3P+ctWZsO+J
Authentication-Results: hotmail.com; spf=none (sender IP is 112.14.115.76) smtp.mailfrom=Leo@roller.net; dkim=none header.d=roller.net; x-hmca=none header.id=Leo@roller.net
X-SID-PRA: Leo@roller.net
X-AUTH-Result: NONE
X-SID-Result: NONE
X-Message-Status: n:n
X-Message-Delivery: Vj0xLjE7dXM9MDtsPTA7YT0wO0Q9MjtHRD0yO1NDTD02
X-Message-Info: 11chDOWqoTlDH6QlznwMAjBs6JjtIkizO/TP9ynQf8WFHZ2uvGZ30wCbB8RgXHe+M2soxdxdlgY8Lt/zfiISlYGeFExtnWWVRCI9E6TgPexFcDil7uEJAsiz/j+VtabHdH3EQ+mxhSzloDk88C+6HvzOtt1BDQbqjti5zfWHKKLp3vqClDbbm9+jfO5Ix8SAnnA/uUHAogRnmWH/6qwP3kZRoCVAczukl+zx0I4DddyefA0ZTrrtRQ==
Received: from Jacky-PC ([112.14.115.76]) by BAY004-MC6F36.hotmail.com with Microsoft SMTPSVC(7.5.7601.23143);
Thu, 23 Jun 2016 00:39:54 -0700
From: "Leo" <Leo@roller.net>
Subject: conveyor roller
To: dhazuken1977@hotmail.com
Content-Type: text/plain
Reply-To: leosu1203@sina.com
Date: Thu, 23 Jun 2016 15:39:57 +0800
X-Priority: 3
X-Library: Indy 9.00.10
Return-Path: Leo@roller.net
Message-ID: <BAY004-MC6F36M9wGmA00307640@BAY004-MC6F36.hotmail.com>
X-OriginalArrivalTime: 23 Jun 2016 07:39:55.0379 (UTC) FILETIME=[6F816C30:01D1CD22]


Sir, how are you ?

please allow me to introduce myself, we are manufacturer of fasteners in china.

Our company now cover more than 10,000 Square meters for production. And our leading products for self-locking flange,flange nuts,weld nuts,relax nuts ,cover flange nut,Cap nut,expansion nuts ,wing nuts,Square weld nut,Rivet nut,tire nut,sleeve nuts. We are mainly export our products for domestic and foreign such as Eu,America, Japan and Middle east.

For our products details ,please check our website:

www.wzlaichi.com

WenZhou laichi Fastener co.,

If you have any interesting,please fell free to contact me.

Best Regards

Leo

Financia [yelachavez@netlife.ec]: Quick Loan

x-store-info:fHNTDlzCF8Nxw6HwcfGQy+S7Ax/lqLSmNphQ3OF+T9E=
Authentication-Results: hotmail.com; spf=pass (sender IP is 200.93.216.252) smtp.mailfrom=yelachavez@netlife.ec; dkim=none header.d=netlife.ec; x-hmca=pass header.id=yelachavez@netlife.ec
X-SID-PRA: yelachavez@netlife.ec
X-AUTH-Result: PASS
X-SID-Result: PASS
X-Message-Status: n:n
X-Message-Delivery: Vj0xLjE7dXM9MDtsPTE7YT0wO0Q9MjtHRD0yO1NDTD00
X-Message-Info: o2JN2MhV56sHHy9zqCGqmbgwrfhx0ApYVQtqCr4BB6JPpZ2PsJ1x9wHIREwbbn6xkG0NCEX5VKkt92WLWpMZ44rDHh6L22OvQnJn2CFK8lXrW5bOJWj+Y4fRzGWbtpyW6jyUUbSgRm4AKEgTTVJ4Estm+pdcyUeaDeGQ8Z9ZNuQm8AcczNftO+zHrGy7GVEBg7olDb8jOxWnlDgglYdj+yJtiASQFjZy4MF/1mPMdPStSfmq8p2C8A==
Received: from smtprelay2.uio.telconet.net ([200.93.216.252]) by BLU004-MC1F21.hotmail.com over TLS secured channel with Microsoft SMTPSVC(7.5.7601.23143);
Thu, 23 Jun 2016 00:27:04 -0700
Received: from correo5.cloudcenter.ec (correo5.cloudcenter.ec [181.198.2.18])
by smtprelay2.uio.telconet.net (8.14.4/8.14.4) with ESMTP id u5N7Q10X021513;
Thu, 23 Jun 2016 02:26:45 -0500
Received: from correo5.cloudcenter.ec (localhost [127.0.0.1])
by correo5.cloudcenter.ec (Postfix) with ESMTPS id 54ECC2E1D0C;
Thu, 23 Jun 2016 02:13:10 -0500 (ECT)
Received: from localhost (localhost [127.0.0.1])
by correo5.cloudcenter.ec (Postfix) with ESMTP id 11F292E1D00;
Thu, 23 Jun 2016 02:13:10 -0500 (ECT)
Received: from correo5.cloudcenter.ec ([127.0.0.1])
by localhost (correo5.cloudcenter.ec [127.0.0.1]) (amavisd-new, port 10026)
with ESMTP id BxlqIUGudWP2; Thu, 23 Jun 2016 02:13:09 -0500 (ECT)
Received: from [192.168.1.100] (unknown [116.202.34.36])
by correo5.cloudcenter.ec (Postfix) with ESMTPSA id AD40D2E1AE1;
Thu, 23 Jun 2016 02:10:38 -0500 (ECT)
Content-Type: multipart/alternative; boundary="===============0909384533=="
MIME-Version: 1.0
Subject: Quick Loan
To: Recipients <yelachavez@netlife.ec>
From: "Financia"<yelachavez@netlife.ec>
Date: Thu, 23 Jun 2016 12:38:39 +0530
Reply-To: loan.financial0093@gmail.com
Message-Id: <20160623071039.AD40D2E1AE1@correo5.cloudcenter.ec>
X-Spam-Status: No, score=4.7 required=6.0 tests=BAD_CREDIT,HTML_MESSAGE,
RCVD_IN_BL_SPAMCOP_NET,RCVD_IN_SORBS_WEB,SPF_PASS autolearn=no version=3.3.1
X-Spam-Level: ****
X-Spam-Checker-Version: SpamAssassin 3.3.1 (2010-03-16) on
smtprelay2.uio.telconet.net
Return-Path: yelachavez@netlife.ec
X-OriginalArrivalTime: 23 Jun 2016 07:27:05.0036 (UTC) FILETIME=[A45868C0:01D1CD20]


We can help you with a genuine loan to meet your needs.
Do you need a personal or business loan without stress and
Quick approval?
Do you need an urgent loan today? No Credit Checks
* LOAN APPROVAL IN 60MINS !!
* GUARANTEED SAME DAY TRANSFER !!
* 100% APPROVAL RATE !!
* LOW INTEREST RATE !!
Regards
Mrs. Hijab Mohammed

外贸客户搜索与开发 [org5@a.70300.org]: 你的坚持与效率就是开发新客户的关键所在

x-store-info:4r51+eLowCe79NzwdU2kR3P+ctWZsO+J
Authentication-Results: hotmail.com; spf=pass (sender IP is 118.184.4.120) smtp.mailfrom=org5@a.70300.org; dkim=none header.d=a.70300.org; x-hmca=pass header.id=org5@a.70300.org
X-SID-PRA: org5@a.70300.org
X-AUTH-Result: PASS
X-SID-Result: PASS
X-Message-Status: n:n
X-Message-Delivery: Vj0xLjE7dXM9MDtsPTA7YT0wO0Q9MjtHRD0yO1NDTD02
X-Message-Info: 11chDOWqoTmCrW816AYsTkon38P5XniuzuuWT+tzHNBVNuNVGN43aE9aU4TJnRppUQU/FOgaZJxdnwmaCPrQyJRjWn9mrwyZsxLuiGhlGF/kzTpx03dtL7m0+mO3QIn590WtYT4CAGCZMtbAVpbuGs/4ERGGhgC8VLYFwO2tdKRh4hq/Za2BfMo8DClr1nHKHCzR/bfX4h2kKIITbWYu1kUt4U/dcsfIgScH2oocrYSVyxXvOx6FkA==
Received: from a.70300.org ([118.184.4.120]) by BAY004-MC4F60.hotmail.com with Microsoft SMTPSVC(7.5.7601.23143);
Wed, 22 Jun 2016 23:21:45 -0700
Received: from 58.250.92.123 (HELO JJKLMM); Thu, 23 Jun 2016 14:22:09 +0800
From: "=?GB2312?B?zeLDs7/Nu6fL0cv30+u/qrei?=" <org5@a.70300.org>
Reply-To: 3163745494@qq.com
To: "dhazuken1977" <dhazuken1977@hotmail.com>
Subject: =?GB2312?B?xOO1xLzhs9bT69Cnwsq+zcrHv6q3otDCv827p7XEudi8/Mv51No=?=
Message-ID: <201606231421471949990@a.70300.org>
Date: Thu, 23 Jun 2016 14:21:47 +0800
X-Mailer: Foxmail 6, 10, 201, 20 [cn]
MIME-Version: 1.0
Content-Type: multipart/related; boundary="----=wwwxxx936_8799_374349921.875"
X-Priority: 3
Return-Path: org5@a.70300.org
X-OriginalArrivalTime: 23 Jun 2016 06:21:46.0087 (UTC) FILETIME=[84783F70:01D1CD17]


&#22=806;&#36152;&#22823;&#29615;&#22659;&#19981;&#22909;&#65311;&#21487;&#=26159;&#20026;&#20160;&#20040;&#36824;&#26377;&#20225;&#19994;&#20570;=&#30340;&#30456;&#24403;&#19981;&#38169;&#65292;&#32780;&#19988;&#3682=4;&#26377;&#25193;&#22823;&#30340;&#36235;&#21183;&#21602;&#65311;&#22=806;&#36152;&#36234;&#26469;&#36234;&#38590;&#20570;&#20102;&#65311;&#27=809;&#26377;&#65292;&#21482;&#26159;&#24744;&#22581;&#22312;&#20102;&#=19968;&#26465;&#25317;&#25380;&#30340;&#36335;&#19978;&#65292;&#26426;=&#20250;&#21464;&#24471;&#36234;&#26469;&#36234;&#23567;&#20102;&#6528=1;&#33021;&#33457;&#38065;&#35299;&#20915;&#30340;&#38382;&#39064;&#65=292;&#37027;&#23601;&#19981;&#26159;&#22823;&#38382;&#39064;&#65281;&#20=154;&#21147;&#34429;&#28982;&#20063;&#21487;&#20197;&#20570;&#65292;&#=20294;&#26159;&#24744;&#36824;&#35201;&#30005;&#33041;&#20570;&#20160;=&#20040;&#65311;&#65311;&#23=458;&#25143;&#25968;&#25454;&#21315;&#21315;&#19975;&#65292;&#25163;&#=24037;&#25910;&#38598;&#20309;&#24180;&#25165;&#26159;&#22836;&#65311;=&#65311;&#21=033;&#29992;&#12304;&#36719;&#20214;&#12305;&#20195;&#26367;&#20154;&#=21147;&#24320;&#21457;&#23458;&#25143;&#24050;&#32463;&#25104;&#20102;=&#36235;&#21183;&#65292;&#24744;&#36824;&#19981;&#25913;&#21464;&#6529=2;&#31561;&#24453;&#30340;&#19981;&#26159;&#23458;&#25143;&#32780;&#26=159;&#32477;&#26395;&#65281;&#21152;QQ695795168&#22312;&#32447;&#28436;&#31034;&#22914;&#20309;&=#24320;&#21457;&#21040;&#24744;&#30340;&#20248;&#36136;&#23458;&#25143=;&#65281;&#21672;&#35810;&#30005;&#35805;&#65306;0755-32801027P8chMR8afKP79ejOS

--- ATTACHED ---
image/jpeg: Nnooo_5703.jpg"

[www-data@live.com]: Nota Fiscal Disponivel (29456)

x-store-info:4r51+eLowCe79NzwdU2kR3P+ctWZsO+J
Authentication-Results: hotmail.com; spf=softfail (sender IP is 104.214.108.101; identity alignment result is fail and alignment mode is relaxed) smtp.mailfrom=www-data@live.com; dkim=none (identity alignment result is pass and alignment mode is relaxed) header.d=hotmail.com; x-hmca=none header.id=dhazuken1977@hotmail.com
X-SID-PRA: dhazuken1977@hotmail.com
X-AUTH-Result: NONE
X-SID-Result: NONE
X-Message-Status: n:n
X-Message-Delivery: Vj0xLjE7dXM9MDtsPTA7YT0wO0Q9MjtHRD0yO1NDTD02
X-Message-Info: 11chDOWqoTkUZW8VFliZNZOrL10vBsPT6TUX2MW85hcnVSUMAzKVnwA45BIWU63lCEWbBcmWJfNbO8fW1Nzf88x3nUHtjFSaVruPpLvHb81GQfhFIL7Z6PMUyS+uq9rg2GjP+mRNu5/nmPk8p4umGT5IxJ+3TDRTLmQS9q3fR8JJNvfjiIyBwmLdaMc64W1p6ojUu08apFXL1fNdBpK5fl2YDzcEJ+bks66KU56cPXD9wjXW6CAGtg==
Received: from fmaodas07.fmaodas07.j2.internal.cloudapp.net ([104.214.108.101]) by COL004-MC2F25.hotmail.com with Microsoft SMTPSVC(7.5.7601.23143);
Wed, 22 Jun 2016 21:02:44 -0700
Received: by fmaodas07.fmaodas07.j2.internal.cloudapp.net (Postfix, from userid 33)
id D511540CB4; Thu, 23 Jun 2016 03:43:37 +0000 (UTC)
To: dhazuken1977@hotmail.com
Subject: Nota Fiscal Disponivel (29456)
X-PHP-Originating-Script: 0:hfxydxicubvwilnibrd.php
MIME-Version: 1.0
Content-type: text/html; charset=iso-8859-1
X-Mailer: Microsoft Office Outlook, Build 17.551210
Content-Transfer-encoding: 8bit
From: dhazuken1977@hotmail.com
Reply-To: dhazuken1977@hotmail.com
X-Mailer: iGMail [www.ig.com.br]
X-Originating-Email: dhazuken1977@hotmail.com
X-Sender: dhazuken1977@hotmail.com
X-iGspam-global: Unsure, spamicity=0.570081 - pe=5.74e-01 - pf=0.574081 - pg=0.574081
Message-Id: <20160623034419.D511540CB4@fmaodas07.fmaodas07.j2.internal.cloudapp.net>
Date: Thu, 23 Jun 2016 03:43:37 +0000 (UTC)
Return-Path: www-data@live.com
X-OriginalArrivalTime: 23 Jun 2016 04:02:44.0982 (UTC) FILETIME=[18C8A160:01D1CD04]


Prezado (A)

Foi emitida uma NF-e (Nota Fiscal Eletrônica) referente ao seu pedido nº 00135343, realizado em 19/06/2016 as 19:04

NF-e Nota Fiscal Eletrônica

Ecolha abaixo a melhor forma de consultar sua NF-e

Visualizar em formato PDF
Visualizar em formato XML

Atençâo: Caso o seu pedido contenha mais produtos com entregas separadas que não constam nesta NF-e aguarde o envio posterioress da semana

Links go to:

https://bitly.com/28MwSWD